Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii prisilkin-39 (LOC108054580), mRNA.


LOCUS       XM_017137622             627 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017137622
VERSION     XM_017137622.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137622.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..627
                     /gene="LOC108054580"
                     /note="prisilkin-39; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108054580"
     CDS             110..478
                     /gene="LOC108054580"
                     /codon_start=1
                     /product="prisilkin-39"
                     /protein_id="XP_016993111.2"
                     /db_xref="GeneID:108054580"
                     /translation="MNSMTVLAILAASLAFCAGDVSHLSRSYLPPVSGAYSGYSSGYS
                     SGYPSYSSGSGYYSGGVGSYASPIVSSSYKSYAVPQYTTYSTPSRTYLPADTGYSGYS
                     GYSGYNGLDTKYGSNGGYVY"
     polyA_site      627
                     /gene="LOC108054580"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tggatcagca acagttgatc gtcggcgtcc aatcggtgca aacatagaag ctatagaagc
       61 ctcaatcctt tcaagaaaca aacagtatct gtctcaaaac attctcaaaa tgaactccat
      121 gaccgtcctc gcaatcctgg ccgcctcgtt ggccttctgt gctggcgatg tgtcgcactt
      181 gtcgcgcagc tacctgcccc ccgtgagcgg cgcctattcc gggtactcct ccggctactc
      241 ctccggatat ccatcgtact ccagtggctc tggatattat tcgggcggcg tcggcagcta
      301 cgcctcgccg atcgtctctt cgtcctacaa gagctacgcg gtgccacagt acaccaccta
      361 ttcgacgccc tcgcgcacct atttgccagc ggacacgggc tactctggat actcgggata
      421 ctccggatac aatggcctgg acaccaagta cggcagcaac ggcggctacg tctactaggc
      481 catgtccacc catcctggga ggccagcaac aatggagcaa gcggacaact atatattcct
      541 atatctacat tttttttttg ccttggctaa gcaacttttt ttgtgcaatt tatggctatt
      601 aatacttttg aatgctttat acagtga