Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137622 627 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017137622 VERSION XM_017137622.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137622.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..627 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..627 /gene="LOC108054580" /note="prisilkin-39; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054580" CDS 110..478 /gene="LOC108054580" /codon_start=1 /product="prisilkin-39" /protein_id="XP_016993111.2" /db_xref="GeneID:108054580" /translation="MNSMTVLAILAASLAFCAGDVSHLSRSYLPPVSGAYSGYSSGYS SGYPSYSSGSGYYSGGVGSYASPIVSSSYKSYAVPQYTTYSTPSRTYLPADTGYSGYS GYSGYNGLDTKYGSNGGYVY" polyA_site 627 /gene="LOC108054580" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggatcagca acagttgatc gtcggcgtcc aatcggtgca aacatagaag ctatagaagc 61 ctcaatcctt tcaagaaaca aacagtatct gtctcaaaac attctcaaaa tgaactccat 121 gaccgtcctc gcaatcctgg ccgcctcgtt ggccttctgt gctggcgatg tgtcgcactt 181 gtcgcgcagc tacctgcccc ccgtgagcgg cgcctattcc gggtactcct ccggctactc 241 ctccggatat ccatcgtact ccagtggctc tggatattat tcgggcggcg tcggcagcta 301 cgcctcgccg atcgtctctt cgtcctacaa gagctacgcg gtgccacagt acaccaccta 361 ttcgacgccc tcgcgcacct atttgccagc ggacacgggc tactctggat actcgggata 421 ctccggatac aatggcctgg acaccaagta cggcagcaac ggcggctacg tctactaggc 481 catgtccacc catcctggga ggccagcaac aatggagcaa gcggacaact atatattcct 541 atatctacat tttttttttg ccttggctaa gcaacttttt ttgtgcaatt tatggctatt 601 aatacttttg aatgctttat acagtga