Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137601 697 bp mRNA linear INV 09-DEC-2024 type 2 (LOC108054566), mRNA. ACCESSION XM_017137601 VERSION XM_017137601.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137601.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..697 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..697 /gene="LOC108054566" /note="peroxisomal multifunctional enzyme type 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108054566" CDS 168..515 /gene="LOC108054566" /codon_start=1 /product="peroxisomal multifunctional enzyme type 2" /protein_id="XP_016993090.1" /db_xref="GeneID:108054566" /translation="MSLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEW TLDCKNAKAYEGPAQGIKVDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLT QKLAPLLKTDAKL" misc_feature 192..497 /gene="LOC108054566" /note="SCP-2 sterol transfer family; Region: SCP2; pfam02036" /db_xref="CDD:460423" polyA_site 697 /gene="LOC108054566" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gagtgcggca tatctgaccg gctccccgca gtatggccat ctcgctcccc cgcgacaagg 61 ggagtgaagc gaccaaaaag cgacaataaa atcgcctctt gcacgccgtc tgctcattat 121 ttcgcgttct ccgctcaaag caaatacaca caccacacac aacaaccatg tctctgcagt 181 cggacgccgt tttccagaag atcatcgatg gactgaagga gaacgaggcc aaggccaagg 241 cggtcaacgg agtgttcctg tacaaaatca ccaaggacgg caaggtggcc aaggagtgga 301 ctctcgactg caagaacgcc aaggcctacg agggacccgc ccagggcatc aaggtggaca 361 ccaccttgac cgtcgccgac gaggacatgg ttgacatcgc cctgggcaag ctgaaccccc 421 aggctgcctt catgaagggc aagctgaaga tcgccggcaa catcatgctc acccagaagt 481 tggcgccgct cctgaagacc gacgccaagt tgtaaaaagg atccccgccg gactagcctg 541 cacattcctt ctttagctcc tttttttttc tacgtgtgta atgtgtattc gtgtttttgt 601 ttcacctaat tcacataatt aatgttattt ttgtacggga aatcgtctac aaaactagaa 661 aataatacat aaggcgaaag cgacaagcga caaacga