Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137600 917 bp mRNA linear INV 09-DEC-2024 methylthioribulose-1-phosphate dehydratase (LOC108054563), mRNA. ACCESSION XM_017137600 VERSION XM_017137600.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137600.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..917 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..917 /gene="LOC108054563" /note="probable methylthioribulose-1-phosphate dehydratase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108054563" CDS 99..782 /gene="LOC108054563" /codon_start=1 /product="probable methylthioribulose-1-phosphate dehydratase" /protein_id="XP_016993089.2" /db_xref="GeneID:108054563" /translation="MALSIFKDLPAEHPRHLIPSLCRQFYHLGWVTGTGGGMSIKHND EIYIAPSGVQKERMQPEDLFVQDITGRDLQLPPEIRGLKKSQCTPLFMLAYQHRQAGA VIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRYDEELVVPIIENTPFE RDLADSMYAAMMEHPGCSAILVRRHGVYVWGQNWEKAKTMSECYDYLFSIAVEMKKAG IDPEKFESS" misc_feature 150..746 /gene="LOC108054563" /note="Class II Aldolase and Adducin head (N-terminal) domain. Aldolases are ubiquitous enzymes catalyzing central steps of carbohydrate metabolism. Based on enzymatic mechanisms, this superfamily has been divided into two distinct classes (Class I and II); Region: Aldolase_II; cl00214" /db_xref="CDD:469663" misc_feature order(156..158,168..170,192..194,258..260,264..269, 417..419,423..428,441..443,456..458,462..464,474..476, 531..533,648..650,681..683,702..704,720..722) /gene="LOC108054563" /note="intersubunit interface [polypeptide binding]; other site" /db_xref="CDD:238232" misc_feature order(207..209,249..254,351..359,411..413,417..419, 651..653) /gene="LOC108054563" /note="active site" /db_xref="CDD:238232" misc_feature order(411..413,417..419,651..653) /gene="LOC108054563" /note="Zn2+ binding site [ion binding]; other site" /db_xref="CDD:238232" polyA_site 917 /gene="LOC108054563" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttcccgcat tgtttacatt cgtgattcgt cgcctttcag cttacagatt tgcctttatc 61 atcccttatc agcatcgcag agtcacgttg tcagcgcgat ggccctctca atcttcaaag 121 acctgccggc ggagcatccc cgccacctga ttccctcgct ctgcaggcag ttctaccacc 181 tgggctgggt caccggcaca ggaggcggca tgagcatcaa gcacaacgat gagatctaca 241 tagcaccgtc gggcgtccag aaggagcgca tgcagccgga ggatctgttc gtgcaggaca 301 taaccggcag ggatctgcag ctgccgccgg agatcagggg cctgaagaag agccagtgca 361 cgccgctctt catgctggcc taccagcacc gccaggcggg cgccgtcatc cacacccact 421 cgcagcacgc cgtcatggcc acgctcctct ggccgggcaa gaccttccgc tgcacccatc 481 tggagatgat caagggcgtc tacgacgagg cggataagcg gtatctgcgc tacgacgagg 541 agctggtcgt acccatcatc gagaatacac cctttgaacg cgacctggcc gacagcatgt 601 acgccgccat gatggagcat cccggctgca gtgccatcct cgtccggcgg cacggcgtct 661 acgtttgggg acagaactgg gagaaggcca agaccatgtc ggaatgctat gactatctct 721 tctccattgc cgtggaaatg aaaaaggccg gaatcgatcc ggagaagttc gaaagctcct 781 aaggaaatgg agctgataaa aaaaacccac acgttgttta accctatgta agccttatat 841 actgcattta ctatcagaga tattctgata tgcaaggcaa tggtactgaa aaaatatatg 901 cgatttaaac agcttaa