Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RNA terminal phosphate cyclase 1


LOCUS       XM_017137566            1299 bp    mRNA    linear   INV 09-DEC-2024
            (Rtc1), mRNA.
ACCESSION   XM_017137566
VERSION     XM_017137566.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137566.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1299
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1299
                     /gene="Rtc1"
                     /note="RNA terminal phosphate cyclase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108054549"
     CDS             101..1246
                     /gene="Rtc1"
                     /codon_start=1
                     /product="probable RNA 3'-terminal phosphate cyclase-like
                     protein"
                     /protein_id="XP_016993055.2"
                     /db_xref="GeneID:108054549"
                     /translation="MPPVAQEGNCLIYRGSNFLKQRLILACLSGKPVKINQIRSEDEA
                     APGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQIHHDCCVQRGIGYY
                     LDALIALGPFCKNPLHCSLRGVTNSRDSPSVDHIKGAALSLLKRFLLVDEGLELKVIR
                     RGVAPLGGGEITFRCPVRKSLRALQFQAQGMVKRIRGTVYACKVSPALANRTVEAAKG
                     CMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCYAADCNSNTREESDTPSI
                     PEDLGQEVAMRLLDEIYRGGCVDSTYQWLAALYIALGQKHVSKFLTGALSTYTVHFLQ
                     HLRDFFSITFKLENPEAEDEDEDVRGAQKVLMACVGIGYTNINKRVT"
     misc_feature    131..1240
                     /gene="Rtc1"
                     /note="18S rRNA biogenesis protein RCL1; Region:
                     18S_RNA_Rcl1p; TIGR03400"
                     /db_xref="CDD:274564"
     polyA_site      1299
                     /gene="Rtc1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgatagcccg ccgattgttg ttgtttacct ctttcaacgc acgtgcgtct cgtaatttgt
       61 gtgattttct agttaatttg gaggatctaa gaactccacg atgccgcccg ttgcccagga
      121 gggcaattgc ctgatctacc gcggcagcaa ctttctcaag cagcgcctaa tcctggcctg
      181 cctgtccggc aagccggtga agatcaacca aatccgctcg gaggacgagg cggcaccggg
      241 tctgcgggaa tacgagatca gtttgatccg tctgctggac aagatcacca acggcaccaa
      301 gatcgaactg aatcccgccg gcacgagtgt catgttctcg ccgggattgc tgcacggcgg
      361 tcagatccat cacgattgct gtgtgcagcg tggcattggt tattacttgg acgccctgat
      421 tgctttgggt cccttctgca agaatccgct gcactgcagc ctgcgcggcg tgaccaacag
      481 cagggattcg ccatcggtgg accacatcaa gggtgcagcc ctctcgctgc tcaagcgctt
      541 ccttctggtc gacgagggcc tggaactgaa ggtcatacgg cgtggagtgg ctcctttggg
      601 cggcggcgag atcacctttc gctgcccggt gcgcaagagc ctgcgcgccc tgcagttcca
      661 ggcgcagggc atggtcaagc gcatccgggg caccgtctac gcctgcaagg tctcgcccgc
      721 cctggccaat cgcaccgtgg aggcggccaa gggctgcatg ctcaagttcc tgcccgatgt
      781 ctatatctac accgatcaga acaagggcaa gatgtctggg aattcacctg gcttcggcat
      841 ctgcctgatt gcggagacca cggacggcgt ttgctacgcc gccgactgca attccaacac
      901 aagggaggag tcggacaccc cctccatacc cgaggatctg ggccaggagg tggccatgcg
      961 tctgctcgac gagatctacc gcggtggctg cgtggattcc acctaccaat ggctggcggc
     1021 actttatata gcattgggac agaagcacgt ctccaaattc ctgaccggcg ctctgtccac
     1081 ctacactgtt cacttcctgc aacatctgcg cgacttcttc tcgatcacct tcaagctgga
     1141 gaatcccgag gcggaggatg aggacgagga tgtgcggggt gcccagaagg tcctgatggc
     1201 ctgtgtcggg attggctaca cgaacatcaa taagcgcgtt acctaaactg ttctcttggc
     1261 taaaaattgt aggaataaat gtattttttt tatcactta