Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137566 1299 bp mRNA linear INV 09-DEC-2024 (Rtc1), mRNA. ACCESSION XM_017137566 VERSION XM_017137566.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137566.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1299 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1299 /gene="Rtc1" /note="RNA terminal phosphate cyclase 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054549" CDS 101..1246 /gene="Rtc1" /codon_start=1 /product="probable RNA 3'-terminal phosphate cyclase-like protein" /protein_id="XP_016993055.2" /db_xref="GeneID:108054549" /translation="MPPVAQEGNCLIYRGSNFLKQRLILACLSGKPVKINQIRSEDEA APGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQIHHDCCVQRGIGYY LDALIALGPFCKNPLHCSLRGVTNSRDSPSVDHIKGAALSLLKRFLLVDEGLELKVIR RGVAPLGGGEITFRCPVRKSLRALQFQAQGMVKRIRGTVYACKVSPALANRTVEAAKG CMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCYAADCNSNTREESDTPSI PEDLGQEVAMRLLDEIYRGGCVDSTYQWLAALYIALGQKHVSKFLTGALSTYTVHFLQ HLRDFFSITFKLENPEAEDEDEDVRGAQKVLMACVGIGYTNINKRVT" misc_feature 131..1240 /gene="Rtc1" /note="18S rRNA biogenesis protein RCL1; Region: 18S_RNA_Rcl1p; TIGR03400" /db_xref="CDD:274564" polyA_site 1299 /gene="Rtc1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgatagcccg ccgattgttg ttgtttacct ctttcaacgc acgtgcgtct cgtaatttgt 61 gtgattttct agttaatttg gaggatctaa gaactccacg atgccgcccg ttgcccagga 121 gggcaattgc ctgatctacc gcggcagcaa ctttctcaag cagcgcctaa tcctggcctg 181 cctgtccggc aagccggtga agatcaacca aatccgctcg gaggacgagg cggcaccggg 241 tctgcgggaa tacgagatca gtttgatccg tctgctggac aagatcacca acggcaccaa 301 gatcgaactg aatcccgccg gcacgagtgt catgttctcg ccgggattgc tgcacggcgg 361 tcagatccat cacgattgct gtgtgcagcg tggcattggt tattacttgg acgccctgat 421 tgctttgggt cccttctgca agaatccgct gcactgcagc ctgcgcggcg tgaccaacag 481 cagggattcg ccatcggtgg accacatcaa gggtgcagcc ctctcgctgc tcaagcgctt 541 ccttctggtc gacgagggcc tggaactgaa ggtcatacgg cgtggagtgg ctcctttggg 601 cggcggcgag atcacctttc gctgcccggt gcgcaagagc ctgcgcgccc tgcagttcca 661 ggcgcagggc atggtcaagc gcatccgggg caccgtctac gcctgcaagg tctcgcccgc 721 cctggccaat cgcaccgtgg aggcggccaa gggctgcatg ctcaagttcc tgcccgatgt 781 ctatatctac accgatcaga acaagggcaa gatgtctggg aattcacctg gcttcggcat 841 ctgcctgatt gcggagacca cggacggcgt ttgctacgcc gccgactgca attccaacac 901 aagggaggag tcggacaccc cctccatacc cgaggatctg ggccaggagg tggccatgcg 961 tctgctcgac gagatctacc gcggtggctg cgtggattcc acctaccaat ggctggcggc 1021 actttatata gcattgggac agaagcacgt ctccaaattc ctgaccggcg ctctgtccac 1081 ctacactgtt cacttcctgc aacatctgcg cgacttcttc tcgatcacct tcaagctgga 1141 gaatcccgag gcggaggatg aggacgagga tgtgcggggt gcccagaagg tcctgatggc 1201 ctgtgtcggg attggctaca cgaacatcaa taagcgcgtt acctaaactg ttctcttggc 1261 taaaaattgt aggaataaat gtattttttt tatcactta