PREDICTED: Drosophila takahashii MICOS complex subunit Mic10

LOCUS       XM_017137545             451 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054543), mRNA.
ACCESSION   XM_017137545
VERSION     XM_017137545.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137545.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..451
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..451
                     /gene="LOC108054543"
                     /note="MICOS complex subunit Mic10; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054543"
     CDS             111..335
                     /gene="LOC108054543"
                     /codon_start=1
                     /product="MICOS complex subunit Mic10"
                     /protein_id="XP_016993034.1"
                     /db_xref="GeneID:108054543"
                     /translation="MSTAPEDRLRENLNRCLSDSLVKGFGGLVIGSVVTLLFFRRRIW
                     PVWLGTGFGVGMAYRGCEKELNEVTFDPQK"
     misc_feature    123..308
                     /gene="LOC108054543"
                     /note="Domain of unknown function (DUF543); Region:
                     DUF543; pfam04418"
                     /db_xref="CDD:461300"
ORIGIN      
        1 caattgtcaa ttcgatttgg ttattgtcgc aatatctggc agcgaaacaa aaaacaaaaa
       61 ttcataaatt atctattaac tattatcggc agcagtgaag tagagtggat atgtcgacgg
      121 cccccgaaga tcgtttgcgc gagaacctca accgctgtct gtcggactcc ctggtgaagg
      181 gattcggagg cctggtgatc ggatcggtgg tcaccctgct cttcttccgg aggcgcattt
      241 ggcccgtctg gctgggcacc ggattcggcg tgggcatggc ctaccggggc tgtgagaagg
      301 agctcaacga ggtgaccttt gacccgcaga agtgatggcg agcaaagaag tggacaatgg
      361 attttacgaa tgctcaaata cggtttaatc ccttgcgttt gttttggaat gtggaacgat
      421 ttgagtaaat gaatgaaggg aaacccattt t