Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137543 1077 bp mRNA linear INV 09-DEC-2024 diphosphatase NUDT8 (LOC108054541), mRNA. ACCESSION XM_017137543 VERSION XM_017137543.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137543.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1077 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1077 /gene="LOC108054541" /note="mitochondrial coenzyme A diphosphatase NUDT8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054541" CDS 72..884 /gene="LOC108054541" /codon_start=1 /product="mitochondrial coenzyme A diphosphatase NUDT8" /protein_id="XP_016993032.2" /db_xref="GeneID:108054541" /translation="MMSQASRRAPQFLLQLNRQLSSSKPPDGQLMNPAELLSPESQLR CMEKMRSLPAFPRPKSLTPSRREKQTSAVLIALCQERGTDQISLLFTRRSRHLRSHSF QISFPGGRRDDQDASYVDCALRETEEEIGLPRHRIQVWGEAKQLHLPRTSSIVPVVGV VPDFSLSELRLNWEEVEEAFSVPLQALMEPQATRHTQFRSGYSGPVFVVDHHRIWGIT GYLTHLFLHSLLPPSQLPDCLRTNIKFIRPFKLPPKLPHHREHSAADPSMRT" misc_feature 282..746 /gene="LOC108054541" /note="coenzyme A pyrophosphatase and similar proteins; Region: NUDIX_CoAse_Nudt7; cd03426" /db_xref="CDD:467532" polyA_site 1077 /gene="LOC108054541" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaagttcgat tcccttggca tttgtttaca tcacattgtt cctccgattt tggactagaa 61 tccccaccac gatgatgtcc caggcgagtc gcagagcgcc gcagttcctc ttgcaactga 121 accgccaact gagctcgtcc aagccgccgg atggccaact gatgaacccc gcggagctcc 181 tcagccccga atcgcagctc aggtgcatgg agaagatgcg cagcctgccg gcttttccgc 241 gacccaagtc cctgacgccc agtcgccggg agaagcaaac ctccgccgtc ctcatcgccc 301 tctgccagga gcggggcaca gaccagattt ccctgctctt cacccgacga tcgcggcacc 361 tgcgcagcca cagcttccag atatccttcc ccggcggccg gcgtgacgat caggacgcca 421 gctacgtgga ctgcgccctg cgggaaacgg aggaggagat cggcctgccg cgccatcgca 481 tccaggtgtg gggcgaggcc aagcagctgc atctgccgcg cacctcgtcc attgtgccgg 541 tggtcggtgt ggtgccagac tttagcctct ccgagctgcg cctcaactgg gaggaggtgg 601 aggaggcgtt cagtgtgccg ctccaggcgc taatggagcc acaggccacc cggcacaccc 661 agttccgcag cggctacagc ggacccgtgt tcgtggtgga ccaccaccgc atctggggca 721 tcaccggcta cctgacgcat ctcttcctgc acagcctgct gccgcccagc cagctgcccg 781 actgcctcag gacgaacatc aagttcattc ggccctttaa gctgcctccc aagctgccgc 841 atcaccgcga gcactccgcc gcggatccct cgatgcgcac atgatcctcc tccgatcaac 901 gagaatccca ctcaggctgc cgccccatgt gatacggaag attattgctt cggtcgaacc 961 gaaaagtagg ctaaattcga tggtgttctt cgttttagtg tagattttta atgtgaatta 1021 catggcaaat tgaggaaatt tgtgtaataa aactgttgat cgttttgttg aaattta