Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial coenzyme A


LOCUS       XM_017137543            1077 bp    mRNA    linear   INV 09-DEC-2024
            diphosphatase NUDT8 (LOC108054541), mRNA.
ACCESSION   XM_017137543
VERSION     XM_017137543.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137543.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1077
                     /gene="LOC108054541"
                     /note="mitochondrial coenzyme A diphosphatase NUDT8;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108054541"
     CDS             72..884
                     /gene="LOC108054541"
                     /codon_start=1
                     /product="mitochondrial coenzyme A diphosphatase NUDT8"
                     /protein_id="XP_016993032.2"
                     /db_xref="GeneID:108054541"
                     /translation="MMSQASRRAPQFLLQLNRQLSSSKPPDGQLMNPAELLSPESQLR
                     CMEKMRSLPAFPRPKSLTPSRREKQTSAVLIALCQERGTDQISLLFTRRSRHLRSHSF
                     QISFPGGRRDDQDASYVDCALRETEEEIGLPRHRIQVWGEAKQLHLPRTSSIVPVVGV
                     VPDFSLSELRLNWEEVEEAFSVPLQALMEPQATRHTQFRSGYSGPVFVVDHHRIWGIT
                     GYLTHLFLHSLLPPSQLPDCLRTNIKFIRPFKLPPKLPHHREHSAADPSMRT"
     misc_feature    282..746
                     /gene="LOC108054541"
                     /note="coenzyme A pyrophosphatase and similar proteins;
                     Region: NUDIX_CoAse_Nudt7; cd03426"
                     /db_xref="CDD:467532"
     polyA_site      1077
                     /gene="LOC108054541"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaagttcgat tcccttggca tttgtttaca tcacattgtt cctccgattt tggactagaa
       61 tccccaccac gatgatgtcc caggcgagtc gcagagcgcc gcagttcctc ttgcaactga
      121 accgccaact gagctcgtcc aagccgccgg atggccaact gatgaacccc gcggagctcc
      181 tcagccccga atcgcagctc aggtgcatgg agaagatgcg cagcctgccg gcttttccgc
      241 gacccaagtc cctgacgccc agtcgccggg agaagcaaac ctccgccgtc ctcatcgccc
      301 tctgccagga gcggggcaca gaccagattt ccctgctctt cacccgacga tcgcggcacc
      361 tgcgcagcca cagcttccag atatccttcc ccggcggccg gcgtgacgat caggacgcca
      421 gctacgtgga ctgcgccctg cgggaaacgg aggaggagat cggcctgccg cgccatcgca
      481 tccaggtgtg gggcgaggcc aagcagctgc atctgccgcg cacctcgtcc attgtgccgg
      541 tggtcggtgt ggtgccagac tttagcctct ccgagctgcg cctcaactgg gaggaggtgg
      601 aggaggcgtt cagtgtgccg ctccaggcgc taatggagcc acaggccacc cggcacaccc
      661 agttccgcag cggctacagc ggacccgtgt tcgtggtgga ccaccaccgc atctggggca
      721 tcaccggcta cctgacgcat ctcttcctgc acagcctgct gccgcccagc cagctgcccg
      781 actgcctcag gacgaacatc aagttcattc ggccctttaa gctgcctccc aagctgccgc
      841 atcaccgcga gcactccgcc gcggatccct cgatgcgcac atgatcctcc tccgatcaac
      901 gagaatccca ctcaggctgc cgccccatgt gatacggaag attattgctt cggtcgaacc
      961 gaaaagtagg ctaaattcga tggtgttctt cgttttagtg tagattttta atgtgaatta
     1021 catggcaaat tgaggaaatt tgtgtaataa aactgttgat cgttttgttg aaattta