Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137542 645 bp mRNA linear INV 09-DEC-2024 CutA (LOC108054540), mRNA. ACCESSION XM_017137542 VERSION XM_017137542.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137542.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..645 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..645 /gene="LOC108054540" /note="divalent-cation tolerance protein CutA; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054540" CDS 111..620 /gene="LOC108054540" /codon_start=1 /product="divalent-cation tolerance protein CutA" /protein_id="XP_016993031.2" /db_xref="GeneID:108054540" /translation="MWWLQYRSCARFLPFRWSLVRNLLIAASVTSVVTIRPAFASSSS ASSKMSESGESYVAGSSSVAFVTTPDRESARKLARSLVEQKLAACVNIVPHIESIYMW EGKVTEDSEFLMMVKTRTSRIDELSKFVRENHPYSVAEVIALPIQNGNPPYLDWIAQT VAEKADKSE" misc_feature 297..590 /gene="LOC108054540" /note="CutA1 divalent ion tolerance protein; Region: CutA1; pfam03091" /db_xref="CDD:460800" ORIGIN 1 ccgcagtctg gcaacgccag gccttgacac acgtcgcctt gtttgttatt ttgattgcat 61 ttcggcaatc ttattgcaat ttcgccttcg tttcgtgccg aacaaagtgc atgtggtggc 121 tgcaatatcg cagctgtgca aggttcttgc cctttcgctg gtcgttggtg cgcaacctgt 181 tgatcgcggc cagcgtcacg agcgtcgtca caatccgccc ggcatttgcc tcgagcagtt 241 cagcctcctc caaaatgagc gaatcagggg aatcctacgt agcgggcagc agttcggtgg 301 ccttcgtcac tacgccggat cgcgaatcgg ccaggaagct ggcccgcagc ctcgtggaac 361 agaaactggc cgcctgcgtg aacatcgtgc cccacatcga gtccatctac atgtgggagg 421 gcaaggtcac cgaggacagc gagttcctga tgatggtcaa gacgcgcacc agccgcatcg 481 acgagctgag caagttcgtc cgcgagaatc atccctacag cgtcgccgag gtcatcgccc 541 tgcccatcca gaatggcaac ccgccctatc tggactggat cgcccagacg gtggcggaga 601 aggcggacaa atcagagtaa aatcaattaa atgcaaataa agaac