Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii divalent-cation tolerance protein


LOCUS       XM_017137542             645 bp    mRNA    linear   INV 09-DEC-2024
            CutA (LOC108054540), mRNA.
ACCESSION   XM_017137542
VERSION     XM_017137542.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137542.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..645
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..645
                     /gene="LOC108054540"
                     /note="divalent-cation tolerance protein CutA; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108054540"
     CDS             111..620
                     /gene="LOC108054540"
                     /codon_start=1
                     /product="divalent-cation tolerance protein CutA"
                     /protein_id="XP_016993031.2"
                     /db_xref="GeneID:108054540"
                     /translation="MWWLQYRSCARFLPFRWSLVRNLLIAASVTSVVTIRPAFASSSS
                     ASSKMSESGESYVAGSSSVAFVTTPDRESARKLARSLVEQKLAACVNIVPHIESIYMW
                     EGKVTEDSEFLMMVKTRTSRIDELSKFVRENHPYSVAEVIALPIQNGNPPYLDWIAQT
                     VAEKADKSE"
     misc_feature    297..590
                     /gene="LOC108054540"
                     /note="CutA1 divalent ion tolerance protein; Region:
                     CutA1; pfam03091"
                     /db_xref="CDD:460800"
ORIGIN      
        1 ccgcagtctg gcaacgccag gccttgacac acgtcgcctt gtttgttatt ttgattgcat
       61 ttcggcaatc ttattgcaat ttcgccttcg tttcgtgccg aacaaagtgc atgtggtggc
      121 tgcaatatcg cagctgtgca aggttcttgc cctttcgctg gtcgttggtg cgcaacctgt
      181 tgatcgcggc cagcgtcacg agcgtcgtca caatccgccc ggcatttgcc tcgagcagtt
      241 cagcctcctc caaaatgagc gaatcagggg aatcctacgt agcgggcagc agttcggtgg
      301 ccttcgtcac tacgccggat cgcgaatcgg ccaggaagct ggcccgcagc ctcgtggaac
      361 agaaactggc cgcctgcgtg aacatcgtgc cccacatcga gtccatctac atgtgggagg
      421 gcaaggtcac cgaggacagc gagttcctga tgatggtcaa gacgcgcacc agccgcatcg
      481 acgagctgag caagttcgtc cgcgagaatc atccctacag cgtcgccgag gtcatcgccc
      541 tgcccatcca gaatggcaac ccgccctatc tggactggat cgcccagacg gtggcggaga
      601 aggcggacaa atcagagtaa aatcaattaa atgcaaataa agaac