Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137407 1363 bp mRNA linear INV 09-DEC-2024 (LOC108054440), mRNA. ACCESSION XM_017137407 VERSION XM_017137407.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137407.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1363 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1363 /gene="LOC108054440" /note="uncharacterized LOC108054440; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108054440" CDS 32..1309 /gene="LOC108054440" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016992896.2" /db_xref="GeneID:108054440" /translation="MDPVTIVLIFGALAALYKTSLPYPKCQINVSSSAPLLVTNIGSQ IILSDYYGLIERNKSEEIQFYCGTGFTFKNDGISQLISDNRMETLICQPDGSFLLQNH GIKIKGDARSVECQNGVAAMFESRIGLPNCKDHTTLLLGNDFQDMGSIKSAALCYDIA GTNLKYLTYITHPTRSRVVKKTHLGDLNKLGFDLSVDGSDRFFKKASQADVDAFWNKD KVLSQMFGTGPFDYASLVQDEALGAQLAGYEGMMSVVWLHSLRTGNWRHWLAALRSAS VSGKQFEVRLGVSGVLEMPESRDGCDLAIDLADGNSLPVPVHIWAHVRDLQPTGAAQD EFVLVGHNSPFLRGDPSAEFCPSVCDEVSWLKGTLFASLHRYPINGLMLCCRVEDVAQ TLDSFYGSTAHAAATTENLKVAEDLVLYELIQK" polyA_site 1363 /gene="LOC108054440" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgaaccagta gtcaatactg aaattttcta gatggatcct gtaactattg tgttaatatt 61 tggcgcgctt gcggcgttgt ataagacttc attgccttat ccaaagtgcc agattaatgt 121 gtcgtcgagt gccccccttc ttgtgacaaa catcggttcc caaattattc tatctgatta 181 ttacggttta attgaacgaa acaaaagcga agaaattcaa ttttattgcg gcactggatt 241 tacattcaaa aatgacggca taagtcagct tatttctgac aacagaatgg aaacgctcat 301 ttgccagcca gatggcagtt ttcttctgca aaatcatgga ataaaaatca agggagatgc 361 aaggagtgtt gagtgtcaga acggagtggc tgccatgttc gagagtcgga tcggtttacc 421 caattgtaag gatcacacta cccttctgtt gggcaacgac tttcaggaca tgggttccat 481 taagagtgcc gccttgtgct acgatatcgc cggaaccaat ctgaagtact taacctatat 541 aacgcatccc acacgcagca gagtggttaa aaagacgcac ttgggagatc tgaataaact 601 tggtttcgat ttaagtgtgg acggtagtga tcggttcttt aagaaggcca gccaggcgga 661 tgtggacgca ttctggaaca aggacaaggt tctgtcgcag atgttcggca ccgggccctt 721 tgactacgcc agcttggtgc aggacgaggc tctgggcgcc cagttggccg gctacgaggg 781 catgatgagc gtcgtctggc tgcacagcct gcgcaccggg aactggaggc actggctggc 841 ggccctgcga tcggccagtg tgtccgggaa acaattcgaa gtccgcctcg gtgtctccgg 901 tgttcttgag atgcccgaaa gtcgggatgg ctgcgacctg gccattgatc tggcggatgg 961 caactcactg cccgtgcccg tccacatttg ggcccatgtg cgcgatctgc agccgactgg 1021 agcagcccag gatgagttcg tccttgtggg acacaactcg cccttcttgc gtggcgatcc 1081 ttctgccgaa ttttgcccat cggtgtgcga cgaggtgtcc tggctgaagg gcaccctgtt 1141 cgccagtctc caccgttatc ccatcaacgg cctgatgctg tgctgccgag tggaggatgt 1201 ggcccagacg ctggattcct tttacggatc gacggcccat gcagcagcca ccaccgaaaa 1261 cttaaaagtg gccgaagact tagttttata tgaactaatt caaaaataaa tttgtaatta 1321 atgaatattc atttggaaaa ataaaatgaa acatgcacaa taa