Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii C-type lectin 37Da (LOC108054435),


LOCUS       XM_017137400             679 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017137400
VERSION     XM_017137400.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137400.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..679
                     /gene="LOC108054435"
                     /note="C-type lectin 37Da; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:108054435"
     CDS             41..613
                     /gene="LOC108054435"
                     /codon_start=1
                     /product="C-type lectin 37Da"
                     /protein_id="XP_016992889.2"
                     /db_xref="GeneID:108054435"
                     /translation="MKMYRTTTLLLILGSAWRSSFAYLPDVNIFTNYRTEVYNGIPSE
                     IDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKG
                     FKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATRE
                     MINDANCKIQMLYVCEATEPKTFKFTYIKW"
     misc_feature    209..568
                     /gene="LOC108054435"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(488..490,500..502,506..508,521..523,527..538,
                     545..553)
                     /gene="LOC108054435"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 aactacggac gccggatagt tgggccttga acaccagcca atgaagatgt accgcacaac
       61 aacgctcctg ctgatcctgg gaagtgcctg gcgttcgtcc tttgcctatc tgcccgatgt
      121 gaacattttt accaactacc gcaccgaagt ctataatggc attccctcgg agattgacac
      181 gacgccattt gtgcggatcg gggacaacta ctactatatc gagccgatga acaaggtcaa
      241 ctggttccag gcggccggcg cctgtcgcat gatgaacgcc cacttggcct ccatcgagga
      301 caagccggaa atggaggcgc tgatcaagta catgaaggcc aagggtttca agaacaacga
      361 ctacttttgg atatcgggca acgacctggg caccgagggc gccttctact ggatgtccaa
      421 cggccggccg atgacctatg ccccctggaa cgggccgaag caaatgccgg acaactacgg
      481 cggcaacgag aactgtgtcc atatgttcgc cacccgggag atgatcaacg atgccaactg
      541 caagatccag atgctctacg tctgcgaggc gacggagccc aaaactttca agtttaccta
      601 cataaagtgg tagttctgta ttcgcttgct aggcttgagc taaataaagg gtagttaatt
      661 aatgggtccc tctttaaga