Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137400 679 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017137400 VERSION XM_017137400.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137400.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..679 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..679 /gene="LOC108054435" /note="C-type lectin 37Da; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108054435" CDS 41..613 /gene="LOC108054435" /codon_start=1 /product="C-type lectin 37Da" /protein_id="XP_016992889.2" /db_xref="GeneID:108054435" /translation="MKMYRTTTLLLILGSAWRSSFAYLPDVNIFTNYRTEVYNGIPSE IDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKG FKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATRE MINDANCKIQMLYVCEATEPKTFKFTYIKW" misc_feature 209..568 /gene="LOC108054435" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(488..490,500..502,506..508,521..523,527..538, 545..553) /gene="LOC108054435" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 aactacggac gccggatagt tgggccttga acaccagcca atgaagatgt accgcacaac 61 aacgctcctg ctgatcctgg gaagtgcctg gcgttcgtcc tttgcctatc tgcccgatgt 121 gaacattttt accaactacc gcaccgaagt ctataatggc attccctcgg agattgacac 181 gacgccattt gtgcggatcg gggacaacta ctactatatc gagccgatga acaaggtcaa 241 ctggttccag gcggccggcg cctgtcgcat gatgaacgcc cacttggcct ccatcgagga 301 caagccggaa atggaggcgc tgatcaagta catgaaggcc aagggtttca agaacaacga 361 ctacttttgg atatcgggca acgacctggg caccgagggc gccttctact ggatgtccaa 421 cggccggccg atgacctatg ccccctggaa cgggccgaag caaatgccgg acaactacgg 481 cggcaacgag aactgtgtcc atatgttcgc cacccgggag atgatcaacg atgccaactg 541 caagatccag atgctctacg tctgcgaggc gacggagccc aaaactttca agtttaccta 601 cataaagtgg tagttctgta ttcgcttgct aggcttgagc taaataaagg gtagttaatt 661 aatgggtccc tctttaaga