Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribosomal protein L7A (RpL7A),


LOCUS       XM_017137395            1122 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017137395
VERSION     XM_017137395.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137395.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1122
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1122
                     /gene="RpL7A"
                     /note="ribosomal protein L7A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108054430"
     CDS             189..1004
                     /gene="RpL7A"
                     /codon_start=1
                     /product="large ribosomal subunit protein eL8"
                     /protein_id="XP_016992884.1"
                     /db_xref="GeneID:108054430"
                     /translation="MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNF
                     GIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFK
                     LLEKYRPESPLAKKQRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLV
                     VIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKA
                     NFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG"
     misc_feature    240..1001
                     /gene="RpL7A"
                     /note="U4/U6.U5 small nuclear ribonucleoprotein SNU13;
                     Region: SNU13; cl42391"
                     /db_xref="CDD:455736"
     misc_feature    order(624..626,633..638,645..647,690..692,696..701,
                     705..710,717..719)
                     /gene="RpL7A"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:411046"
     polyA_site      1122
                     /gene="RpL7A"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actatttctt ttccgttcca cgttttcggt gagtgcatgt gcctggcgag cagctctcga
       61 gttttgtact aaaaaacctc tttttaattt acttgcagcg agtatttcga tacgttcgcg
      121 atcgtgttag tcccagcaat ttaagcatct gcttatttcg gtagtaacct taaaacaact
      181 gcttgaaaat ggttgttaag aagcccaggc caaagaagaa gccagtgacc aagaaggtgg
      241 ctcccgctcc tctggctgtc aagaagcccg tggtcaagaa ggtcgtcaac cagctgttcg
      301 agaagcgtcc caagaacttt ggaatcggcc agaatgtgca gcccaagcgc gatctgtccc
      361 gtttcgttcg ctggcccaaa tacatccgtg tccagcgcca gaaggctgtg ctccagaagc
      421 gcctgaaggt cccaccacca atccatcagt tcagccagac tctggacaag accaccgccg
      481 tgaagctgtt caagctgctg gagaagtacc gccccgaatc gccgctggcc aagaagcagc
      541 gcttgaagaa gatcgccgag gccaaggcca agggcaagga tgtggagccc aagaagaagc
      601 ccagctatgt gtccgccggt accaacacgg tcaccaagct gatcgagcag aagaaggccc
      661 agctggtggt cattgcccac gatgttgatc ctctggagct ggtgctcttc ctgcccgccc
      721 tctgccgcaa gatgggcgtg ccctactgca tcgtcaaggg caaggctcgt ctgggtcgcc
      781 tggtgcgtcg caagacctgc accaccctcg ccctgaccac cgtcgacaac aacgacaagg
      841 ccaacttcgg caaggtcctg gaggccgtca agaccaactt caacgagcgc cacgaggaga
      901 tccgtcgcca ctggggcggt ggcatcctgg gctccaagag tctggcccgc atctccaagc
      961 tggagcgcgc caaggcccgc gagctggccc agaagcaggg ttaattcgat cgatcgatcg
     1021 aactgatcag gtggagactt taagtacaca cgatggatga tgaaatgatt tgggccaccg
     1081 gcccactgag ttttgataac aaataaacat ttaagtgtac aa