Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137395 1122 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017137395 VERSION XM_017137395.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137395.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1122 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1122 /gene="RpL7A" /note="ribosomal protein L7A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108054430" CDS 189..1004 /gene="RpL7A" /codon_start=1 /product="large ribosomal subunit protein eL8" /protein_id="XP_016992884.1" /db_xref="GeneID:108054430" /translation="MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNF GIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFK LLEKYRPESPLAKKQRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLV VIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKA NFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG" misc_feature 240..1001 /gene="RpL7A" /note="U4/U6.U5 small nuclear ribonucleoprotein SNU13; Region: SNU13; cl42391" /db_xref="CDD:455736" misc_feature order(624..626,633..638,645..647,690..692,696..701, 705..710,717..719) /gene="RpL7A" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:411046" polyA_site 1122 /gene="RpL7A" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actatttctt ttccgttcca cgttttcggt gagtgcatgt gcctggcgag cagctctcga 61 gttttgtact aaaaaacctc tttttaattt acttgcagcg agtatttcga tacgttcgcg 121 atcgtgttag tcccagcaat ttaagcatct gcttatttcg gtagtaacct taaaacaact 181 gcttgaaaat ggttgttaag aagcccaggc caaagaagaa gccagtgacc aagaaggtgg 241 ctcccgctcc tctggctgtc aagaagcccg tggtcaagaa ggtcgtcaac cagctgttcg 301 agaagcgtcc caagaacttt ggaatcggcc agaatgtgca gcccaagcgc gatctgtccc 361 gtttcgttcg ctggcccaaa tacatccgtg tccagcgcca gaaggctgtg ctccagaagc 421 gcctgaaggt cccaccacca atccatcagt tcagccagac tctggacaag accaccgccg 481 tgaagctgtt caagctgctg gagaagtacc gccccgaatc gccgctggcc aagaagcagc 541 gcttgaagaa gatcgccgag gccaaggcca agggcaagga tgtggagccc aagaagaagc 601 ccagctatgt gtccgccggt accaacacgg tcaccaagct gatcgagcag aagaaggccc 661 agctggtggt cattgcccac gatgttgatc ctctggagct ggtgctcttc ctgcccgccc 721 tctgccgcaa gatgggcgtg ccctactgca tcgtcaaggg caaggctcgt ctgggtcgcc 781 tggtgcgtcg caagacctgc accaccctcg ccctgaccac cgtcgacaac aacgacaagg 841 ccaacttcgg caaggtcctg gaggccgtca agaccaactt caacgagcgc cacgaggaga 901 tccgtcgcca ctggggcggt ggcatcctgg gctccaagag tctggcccgc atctccaagc 961 tggagcgcgc caaggcccgc gagctggccc agaagcaggg ttaattcgat cgatcgatcg 1021 aactgatcag gtggagactt taagtacaca cgatggatga tgaaatgatt tgggccaccg 1081 gcccactgag ttttgataac aaataaacat ttaagtgtac aa