Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Hexosaminidase 2 (Hexo2), mRNA.


LOCUS       XM_017137368            2061 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017137368
VERSION     XM_017137368.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137368.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2061
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2061
                     /gene="Hexo2"
                     /note="Hexosaminidase 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054413"
     CDS             126..1988
                     /gene="Hexo2"
                     /codon_start=1
                     /product="chitooligosaccharidolytic
                     beta-N-acetylglucosaminidase"
                     /protein_id="XP_016992857.2"
                     /db_xref="GeneID:108054413"
                     /translation="MRFSGHHRYFDRYQCFCSAVASLLLCFAVGAALTRADDPPPDGS
                     RTLAKWLCSRTDICTSEAEKVEGLQYAPEVFESQRDCRLSCGKYGAIWPMPTGRECSI
                     SHGRVRFDPWKVRFHVVAPGEAATQFLRETNRLFVSNLLKECTRNCTLESSKQILVRS
                     TVANESLVLDWPTDESYALVVRTTDTATFVDIQATTVYGARHAFETLSNLVTGGQSNG
                     LLMTSTANITDRPAFPHRGVLLDTARNFVPLKFIRSTLDAMAASKLNVLHWHVVDTHS
                     FPLEITRVPEMQRYGAYSSAQTYSRQDALNLVKYARLRGIRILIEIDGPSHAGNGWQW
                     GPSAGLGNMSVCLNQSPWRRFCVQPPCGQLNPLNDHMYAVLKEILEDVAEVGAPEETL
                     HMGGDEVFLPCWNNTDEIRDGMRARGFDLSEQSFLRLWSQFHQRNLNAWDEINERMYP
                     GIREPKSVIIWSSHLTNPRYIEAYLPKERFIIQTWVESQDALNRELLQRGYRLIVSTK
                     NAWYLDHGFWGSTSYYNWRTVYSSAMPMGRSKDQVLGGEVCMWSEYVDQNSLESRIWP
                     RAGAAAERLWSNPKSSALLAQRRFYRYRERLLARGIHADAVIPHWCVLHEGQCL"
     misc_feature    396..755
                     /gene="Hexo2"
                     /note="Glycosyl hydrolase family 20, domain 2; Region:
                     Glyco_hydro_20b; cl03741"
                     /db_xref="CDD:446174"
     misc_feature    822..1928
                     /gene="Hexo2"
                     /note="Beta-N-acetylhexosaminidases catalyze the removal
                     of beta-1,4-linked N-acetyl-D-hexosamine residues from the
                     non-reducing ends of N-acetyl-beta-D-hexosaminides
                     including N-acetylglucosides and N-acetylgalactosides. The
                     hexA and hexB genes encode the...; Region:
                     GH20_HexA_HexB-like; cd06562"
                     /db_xref="CDD:119332"
     misc_feature    order(855..857,942..944,1104..1106,1314..1319,1506..1508,
                     1578..1580,1659..1661,1665..1667,1776..1778,1782..1784)
                     /gene="Hexo2"
                     /note="active site"
                     /db_xref="CDD:119332"
     polyA_site      2061
                     /gene="Hexo2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttttgttgc gcccggcgag cggagcgggt gggcggtgag caggcggcga aaaataccaa
       61 ataccaaaaa tacaaaaaat tataaaagcg gccggcgcag ccgaggaagc cgttagaaag
      121 gaacgatgcg gttcagcggc caccaccgtt atttcgaccg ttatcagtgc ttctgctcgg
      181 cggttgcttc gctgctgctc tgcttcgcgg tgggcgcggc gctgacgcgg gcggatgacc
      241 cgcccccgga tggatcaagg acattggcga agtggctgtg cagccggacg gacatctgca
      301 cctcggaggc ggagaaggtc gagggcctcc agtacgcgcc ggaggtcttt gagagccagc
      361 gggactgccg gctgtcgtgc gggaagtacg gggccatctg gccgatgccc acgggcaggg
      421 agtgcagcat ctcgcacggc cgggtgcgct tcgatccgtg gaaggtgcgc ttccatgtgg
      481 tggcgcccgg cgaggcggcc acccagtttc tgcgcgagac gaaccggctg ttcgtctcga
      541 atctcctgaa ggaatgcacg cgcaactgca cgctggagag cagcaagcag atcctggtca
      601 ggtcgacggt ggccaacgag agtctcgtgc tcgactggcc caccgatgag agctacgctt
      661 tggtggtgcg gaccacggac acggccacct ttgtggacat tcaggcgacg acggtctacg
      721 gagcccggca tgccttcgaa acgctgagca acctggtcac cggcggccag tccaatggcc
      781 tgctgatgac ctccacggcc aacatcacag atcgtcctgc cttcccgcat cgcggggtgc
      841 tcctcgacac ggccaggaac tttgtgcccc tgaagttcat ccggagcacg ctggatgcca
      901 tggccgccag caagctgaat gtgctgcact ggcatgtggt ggacacgcac agcttcccgc
      961 tggagatcac ccgcgtgccg gagatgcagc gctacggggc ttattcctcc gcgcagacct
     1021 actcccgcca ggatgccttg aatctggtca agtacgcccg gctccggggc atccgcatcc
     1081 tgatcgagat cgatgggccc tcgcatgcgg gcaacggctg gcagtgggga ccctcggcgg
     1141 gattgggcaa catgtccgtg tgcctgaatc agtcgccctg gcggagattc tgcgtgcagc
     1201 cgccgtgcgg ccaactgaat cccctgaacg atcacatgta cgccgtgctg aaggagattc
     1261 tcgaggacgt ggccgaggtg ggggcgccgg aggagaccct ccacatgggc ggcgacgagg
     1321 tcttcctgcc ctgctggaac aacaccgatg agatcaggga tggaatgcgt gcccggggct
     1381 tcgatctcag cgagcagagc ttcctgcgcc tgtggtcgca gtttcatcaa aggaatctca
     1441 atgcctggga cgagatcaac gagcgcatgt atccgggcat cagggagccc aagtcggtga
     1501 tcatctggtc cagtcacctg accaatccgc gctacatcga ggcctatctg cccaaggagc
     1561 gcttcatcat tcagacctgg gtggagtcgc aggatgccct gaatcgggag ctcctgcagc
     1621 ggggctaccg gctgattgtg tcgaccaaga atgcctggta tttggatcac ggattctggg
     1681 gcagcacctc ctactacaac tggcggacgg tctactcgag cgcaatgccc atgggtcgca
     1741 gcaaggatca ggtgctgggc ggcgaggtgt gcatgtggag cgagtatgtg gaccagaact
     1801 cactggaatc ccgcatctgg ccgagagccg gagctgccgc cgagcgtctg tggtccaatc
     1861 ccaagtcgtc tgctttgctc gcccagcgga ggttctatcg ctaccgggag cgactcctgg
     1921 cccgcggcat ccatgcggac gcggtcatcc cgcactggtg cgtcctccac gagggccagt
     1981 gcctttgaag atacctcctt tcagcctatg ttaccctctc ccctcatcag ttattgccca
     2041 taaagatctg tttttaatcc a