Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137361 976 bp mRNA linear INV 09-DEC-2024 (LOC108054409), mRNA. ACCESSION XM_017137361 VERSION XM_017137361.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137361.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..976 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..976 /gene="LOC108054409" /note="calcyclin-binding protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054409" CDS 143..850 /gene="LOC108054409" /codon_start=1 /product="calcyclin-binding protein" /protein_id="XP_016992850.2" /db_xref="GeneID:108054409" /translation="MSLEQLKSDVAEIAAFLAQAKGARVKGVLTTAKAEAEREIVNLE MKAKIAAEREASGSGDAKRYLHELTNYGWDQSEKFVKLFITLNGVQGCTEEDVTVSYT PTSLQLHVRDLQGKDFGLTVNNLLHGIDVDKSYRKIKQNMVAIYLKKSKDDVHWDVLT AIQKRLKQKADSELSKDSDNPESALVNIMKKMYNEGDSKTKQMIAKAWTESQDKAKLG KEAGGGLAGGLDTLGDL" misc_feature 143..>286 /gene="LOC108054409" /note="Siah interacting protein, N terminal; Region: Siah-Interact_N; pfam09032" /db_xref="CDD:462660" misc_feature 344..622 /gene="LOC108054409" /note="p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP). CacyBP/SIP interacts with S100A6 (calcyclin), with some other members of the S100 family, with tubulin, and with Siah-1 and Skp-1. The latter...; Region: p23_CacyBP; cd06468" /db_xref="CDD:107225" ORIGIN 1 ggtattttcc gcaatgtgct ccgctcgcgg cacgcgttat tcgtctttta gcacattccg 61 cgcgggcgcc ggcgtcattg aattgctcga aatttctgcg attttacgaa attaaccagc 121 tgccattcgc aattcacacg aaatgtccct ggaacagctc aagagcgatg tggccgaaat 181 tgcggccttt ctggcgcagg cgaaaggtgc ccgcgtaaaa ggcgtgctga ccaccgccaa 241 agcggaggcc gagcgggaga tcgtcaacct ggagatgaag gccaagattg ccgcggagcg 301 agaggcctcg ggatccggag atgccaagag atatctgcac gagctgacca actacggctg 361 ggaccagagt gagaaattcg tgaagctctt catcacgctg aacggcgtgc agggctgcac 421 ggaggaggat gtgaccgtca gctatacgcc cacctcgctg cagctgcacg ttcgcgatct 481 gcagggcaag gactttggcc tgaccgtaaa caatctgctg cacggcattg atgtggacaa 541 gagctaccgc aagatcaagc aaaatatggt ggccatctat ctgaagaagt ccaaggacga 601 tgtccactgg gacgtcctca ccgccatcca gaagcgactg aaacagaagg ccgacagcga 661 gctgagcaag gacagcgata acccggaatc ggcgctggtc aacatcatga agaagatgta 721 caacgagggc gactccaaga cgaagcagat gattgccaag gcctggaccg agagtcagga 781 taaggccaag ttgggcaagg aggcgggcgg aggcttggcc ggcggtctgg acactctcgg 841 cgatctctag atattacatt aaacccacca tccaaatgta atgtattgct aaatacctaa 901 gcactgcttt gattccagca cactttgtat atgtggataa ataaaaaata aataaagtcc 961 tgcgagggca ttaagt