Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii calcyclin-binding protein


LOCUS       XM_017137361             976 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054409), mRNA.
ACCESSION   XM_017137361
VERSION     XM_017137361.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137361.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..976
                     /gene="LOC108054409"
                     /note="calcyclin-binding protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054409"
     CDS             143..850
                     /gene="LOC108054409"
                     /codon_start=1
                     /product="calcyclin-binding protein"
                     /protein_id="XP_016992850.2"
                     /db_xref="GeneID:108054409"
                     /translation="MSLEQLKSDVAEIAAFLAQAKGARVKGVLTTAKAEAEREIVNLE
                     MKAKIAAEREASGSGDAKRYLHELTNYGWDQSEKFVKLFITLNGVQGCTEEDVTVSYT
                     PTSLQLHVRDLQGKDFGLTVNNLLHGIDVDKSYRKIKQNMVAIYLKKSKDDVHWDVLT
                     AIQKRLKQKADSELSKDSDNPESALVNIMKKMYNEGDSKTKQMIAKAWTESQDKAKLG
                     KEAGGGLAGGLDTLGDL"
     misc_feature    143..>286
                     /gene="LOC108054409"
                     /note="Siah interacting protein, N terminal; Region:
                     Siah-Interact_N; pfam09032"
                     /db_xref="CDD:462660"
     misc_feature    344..622
                     /gene="LOC108054409"
                     /note="p23_like domain found in proteins similar to
                     Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting
                     protein (SIP). CacyBP/SIP interacts with S100A6
                     (calcyclin), with some other members of the S100 family,
                     with tubulin, and with Siah-1 and Skp-1. The latter...;
                     Region: p23_CacyBP; cd06468"
                     /db_xref="CDD:107225"
ORIGIN      
        1 ggtattttcc gcaatgtgct ccgctcgcgg cacgcgttat tcgtctttta gcacattccg
       61 cgcgggcgcc ggcgtcattg aattgctcga aatttctgcg attttacgaa attaaccagc
      121 tgccattcgc aattcacacg aaatgtccct ggaacagctc aagagcgatg tggccgaaat
      181 tgcggccttt ctggcgcagg cgaaaggtgc ccgcgtaaaa ggcgtgctga ccaccgccaa
      241 agcggaggcc gagcgggaga tcgtcaacct ggagatgaag gccaagattg ccgcggagcg
      301 agaggcctcg ggatccggag atgccaagag atatctgcac gagctgacca actacggctg
      361 ggaccagagt gagaaattcg tgaagctctt catcacgctg aacggcgtgc agggctgcac
      421 ggaggaggat gtgaccgtca gctatacgcc cacctcgctg cagctgcacg ttcgcgatct
      481 gcagggcaag gactttggcc tgaccgtaaa caatctgctg cacggcattg atgtggacaa
      541 gagctaccgc aagatcaagc aaaatatggt ggccatctat ctgaagaagt ccaaggacga
      601 tgtccactgg gacgtcctca ccgccatcca gaagcgactg aaacagaagg ccgacagcga
      661 gctgagcaag gacagcgata acccggaatc ggcgctggtc aacatcatga agaagatgta
      721 caacgagggc gactccaaga cgaagcagat gattgccaag gcctggaccg agagtcagga
      781 taaggccaag ttgggcaagg aggcgggcgg aggcttggcc ggcggtctgg acactctcgg
      841 cgatctctag atattacatt aaacccacca tccaaatgta atgtattgct aaatacctaa
      901 gcactgcttt gattccagca cactttgtat atgtggataa ataaaaaata aataaagtcc
      961 tgcgagggca ttaagt