Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137356 762 bp mRNA linear INV 09-DEC-2024 (LOC108054404), transcript variant X2, mRNA. ACCESSION XM_017137356 VERSION XM_017137356.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137356.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..762 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..762 /gene="LOC108054404" /note="uncharacterized LOC108054404; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108054404" CDS 183..599 /gene="LOC108054404" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_016992845.1" /db_xref="GeneID:108054404" /translation="MHRRDNRCEICNAVFDISEERVSLKQMMRTFCCGRCCGLIVKHL LFSASLMPLAHIILQQVLQCMDNLNQGSTEQLTVQEVFVASCALLTSSALFFHFFEFV TTRCLLIRNILRHWWMFGSTSDFALVEIEDDSIDLF" polyA_site 762 /gene="LOC108054404" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acccataact aggcgtccct cgcaggagag cgtccactcg gcgaacgaga atggcaactc 61 gtgccgcatt tgccgctgga atcgcagcga tatggagatc atcaagtgtc cctgcaattg 121 caagggcagc gtggtgacct ttgcagggat tcatccacct gaagtgcctg aagcgctgga 181 ttatgcacag gcgggataat cgctgcgaga tctgcaatgc ggtcttcgac atctcggagg 241 agcgggtcag cctgaagcag atgatgcgaa ccttttgctg cggtcgctgt tgcggcctga 301 tcgtaaagca cctgctgttt agcgcctcac tgatgccact ggcccacatc attttgcagc 361 aggttctgca gtgcatggat aatctcaacc agggcagcac cgagcagctc accgtccagg 421 aggtgttcgt cgcctcctgc gcccttttga cctccagcgc ccttttcttt cacttcttcg 481 agttcgtcac cacgcgctgc ctgctcatcc ggaacatcct gcgccactgg tggatgttcg 541 gcagcacctc cgactttgcc ctggtggaga tcgaggacga ctccatcgat ctcttttgat 601 caggataata aaaagatgtt aaaaaggctg cgagcgaaag gggtgaacgg tgcaattttc 661 caccgaccaa cagacatctt cgatgatttc actaagatct gatctagtta gaacaaattt 721 taattttcaa taaaaccagt ttcactattt ttcccataag aa