Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017137356             762 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054404), transcript variant X2, mRNA.
ACCESSION   XM_017137356
VERSION     XM_017137356.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137356.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..762
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..762
                     /gene="LOC108054404"
                     /note="uncharacterized LOC108054404; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108054404"
     CDS             183..599
                     /gene="LOC108054404"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_016992845.1"
                     /db_xref="GeneID:108054404"
                     /translation="MHRRDNRCEICNAVFDISEERVSLKQMMRTFCCGRCCGLIVKHL
                     LFSASLMPLAHIILQQVLQCMDNLNQGSTEQLTVQEVFVASCALLTSSALFFHFFEFV
                     TTRCLLIRNILRHWWMFGSTSDFALVEIEDDSIDLF"
     polyA_site      762
                     /gene="LOC108054404"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acccataact aggcgtccct cgcaggagag cgtccactcg gcgaacgaga atggcaactc
       61 gtgccgcatt tgccgctgga atcgcagcga tatggagatc atcaagtgtc cctgcaattg
      121 caagggcagc gtggtgacct ttgcagggat tcatccacct gaagtgcctg aagcgctgga
      181 ttatgcacag gcgggataat cgctgcgaga tctgcaatgc ggtcttcgac atctcggagg
      241 agcgggtcag cctgaagcag atgatgcgaa ccttttgctg cggtcgctgt tgcggcctga
      301 tcgtaaagca cctgctgttt agcgcctcac tgatgccact ggcccacatc attttgcagc
      361 aggttctgca gtgcatggat aatctcaacc agggcagcac cgagcagctc accgtccagg
      421 aggtgttcgt cgcctcctgc gcccttttga cctccagcgc ccttttcttt cacttcttcg
      481 agttcgtcac cacgcgctgc ctgctcatcc ggaacatcct gcgccactgg tggatgttcg
      541 gcagcacctc cgactttgcc ctggtggaga tcgaggacga ctccatcgat ctcttttgat
      601 caggataata aaaagatgtt aaaaaggctg cgagcgaaag gggtgaacgg tgcaattttc
      661 caccgaccaa cagacatctt cgatgatttc actaagatct gatctagtta gaacaaattt
      721 taattttcaa taaaaccagt ttcactattt ttcccataag aa