Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NTF2-related export protein-like


LOCUS       XM_017137337             603 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054401), mRNA.
ACCESSION   XM_017137337
VERSION     XM_017137337.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137337.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..603
                     /gene="LOC108054401"
                     /note="NTF2-related export protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:108054401"
     CDS             64..492
                     /gene="LOC108054401"
                     /codon_start=1
                     /product="NTF2-related export protein-like"
                     /protein_id="XP_016992826.2"
                     /db_xref="GeneID:108054401"
                     /translation="MNDQIKSQLQEGARIYYESIDDPQKRQEMGKLYHENAKNTWQGA
                     RTRGRDQILNLIMGLPPTKHSYITMHAHVVSKSDYLVDITGNVDYGGLPCKFQHTFIL
                     DVEDDFDWKICSDTYFVEDLSEDSDSTEEMLDNFISRYDY"
     misc_feature    109..426
                     /gene="LOC108054401"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cl09109"
                     /db_xref="CDD:471850"
     polyA_site      603
                     /gene="LOC108054401"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcatagaca tttggcagcc ataatttagt ctacgactaa aaatcagcga gaaaggttga
       61 aaaatgaacg accaaataaa aagccagcta caggagggcg ctaggatcta ctacgaatcc
      121 attgacgacc cgcagaaacg ccaagaaatg ggaaagttgt accatgagaa tgccaaaaac
      181 acctggcagg gagctaggac aaggggccgc gaccagatcc tgaatctcat catgggcctg
      241 cccccgacca agcatagcta catcacaatg cacgcccatg tcgtctccaa atcggactac
      301 ctagtcgata tcaccggcaa cgttgactac ggcggactgc cgtgcaagtt tcagcacacc
      361 ttcattttgg acgtcgagga cgacttcgac tggaagattt gctccgacac ctacttcgtg
      421 gaggacttgt ccgaagattc ggattcaacc gaggaaatgc tcgacaattt tatctcacgc
      481 tatgactact agatgggcta gaattcgtag gatttttttc aagaatgcca accctgaaag
      541 aaaaatggta gcttaataaa tctgaatttt agggttgcct ctggtaattc atttcaaatg
      601 aaa