Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137337 603 bp mRNA linear INV 09-DEC-2024 (LOC108054401), mRNA. ACCESSION XM_017137337 VERSION XM_017137337.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137337.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..603 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..603 /gene="LOC108054401" /note="NTF2-related export protein-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108054401" CDS 64..492 /gene="LOC108054401" /codon_start=1 /product="NTF2-related export protein-like" /protein_id="XP_016992826.2" /db_xref="GeneID:108054401" /translation="MNDQIKSQLQEGARIYYESIDDPQKRQEMGKLYHENAKNTWQGA RTRGRDQILNLIMGLPPTKHSYITMHAHVVSKSDYLVDITGNVDYGGLPCKFQHTFIL DVEDDFDWKICSDTYFVEDLSEDSDSTEEMLDNFISRYDY" misc_feature 109..426 /gene="LOC108054401" /note="Nuclear transport factor 2 (NTF2-like) superfamily. This family includes members of the NTF2 family, Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases, and the beta subunit of Ring hydroxylating dioxygenases. This family is a classic example of...; Region: NTF2_like; cl09109" /db_xref="CDD:471850" polyA_site 603 /gene="LOC108054401" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcatagaca tttggcagcc ataatttagt ctacgactaa aaatcagcga gaaaggttga 61 aaaatgaacg accaaataaa aagccagcta caggagggcg ctaggatcta ctacgaatcc 121 attgacgacc cgcagaaacg ccaagaaatg ggaaagttgt accatgagaa tgccaaaaac 181 acctggcagg gagctaggac aaggggccgc gaccagatcc tgaatctcat catgggcctg 241 cccccgacca agcatagcta catcacaatg cacgcccatg tcgtctccaa atcggactac 301 ctagtcgata tcaccggcaa cgttgactac ggcggactgc cgtgcaagtt tcagcacacc 361 ttcattttgg acgtcgagga cgacttcgac tggaagattt gctccgacac ctacttcgtg 421 gaggacttgt ccgaagattc ggattcaacc gaggaaatgc tcgacaattt tatctcacgc 481 tatgactact agatgggcta gaattcgtag gatttttttc aagaatgcca accctgaaag 541 aaaaatggta gcttaataaa tctgaatttt agggttgcct ctggtaattc atttcaaatg 601 aaa