Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii chromo domain-containing protein


LOCUS       XM_017137332            1139 bp    mRNA    linear   INV 09-DEC-2024
            rhino-like (LOC108054397), mRNA.
ACCESSION   XM_017137332
VERSION     XM_017137332.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137332.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1139
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1139
                     /gene="LOC108054397"
                     /note="chromo domain-containing protein rhino-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108054397"
     CDS             47..901
                     /gene="LOC108054397"
                     /codon_start=1
                     /product="chromo domain-containing protein rhino-like"
                     /protein_id="XP_016992821.2"
                     /db_xref="GeneID:108054397"
                     /translation="MSSGQPEKPCDSAAAEASATSAPDCNVYVVEKIVGKRLKGGRLQ
                     YLVKWLGFSDEENTWEPLEGVIHCCDLLADFEAELLRRSQGQNAGGDQEQKQPQGATK
                     KTRKSTKKPKRRHSSSVSREMEQPEAEVQAVINPPVKGKGKGNPKAPIPRRHSCSHLE
                     SNADPVDLEMQRIHSSPVDMMPPQVGGHEDTPSKDDLPSSGEESIASEDGPDSWKMPE
                     RTKPFGLERGLELEKVHHCFKVRDKTFLFVSWKGCDEVDAVRLEEIRQAYPIPIIKFF
                     EGLKLSDH"
     misc_feature    128..277
                     /gene="LOC108054397"
                     /note="CHROMO (CHRromatin Organization Modifier) domains
                     and chromo shadow domains; Region: CD_CSD; cd00024"
                     /db_xref="CDD:349274"
     misc_feature    order(128..142,185..187,191..202,212..214,218..229,
                     233..238,257..259,266..271)
                     /gene="LOC108054397"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:349274"
     misc_feature    731..877
                     /gene="LOC108054397"
                     /note="chromo shadow domain; Region: CSD; cd00034"
                     /db_xref="CDD:349275"
     misc_feature    order(743..745,749..763,785..787,812..814,872..874)
                     /gene="LOC108054397"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:349275"
     misc_feature    order(761..763,776..778,827..832,851..856,860..865,
                     872..877)
                     /gene="LOC108054397"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:349275"
     polyA_site      1139
                     /gene="LOC108054397"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgggtgcca ctcttttttc tttttttttt gtgtcgaaaa gaaaacatgt ctagtggaca
       61 gccggaaaag ccctgtgact ccgcagccgc cgaagcatcc gcaaccagcg caccggactg
      121 caatgtgtat gtggtggaga agatcgtggg caagcgcctg aagggcgggc gtcttcagta
      181 cctggtgaag tggctgggct tctcggacga ggagaacacc tgggagccgc tggagggagt
      241 gatccactgc tgcgatctgc tggccgactt cgaggcagag ctcttgcggc gcagccaggg
      301 gcagaacgcc ggtggcgatc aggagcagaa gcagccgcag ggggcaacca agaagacccg
      361 gaaatccacc aagaagccaa agcgcaggca ttcatcgagt gtttctcggg aaatggagca
      421 gcccgaggcg gaagtccagg ctgtgatcaa tcctcctgtt aagggcaagg gcaagggcaa
      481 tccaaaggct ccgatacccc gacgtcactc atgctctcat ctggagagca acgcagaccc
      541 ggttgacttg gaaatgcagc gcatccacag ctcaccggtg gacatgatgc cgccgcaggt
      601 cggtggccac gaggatacgc catccaaaga cgatctcccg agttccgggg aggagtcgat
      661 cgcctcggag gacggtccag atagctggaa aatgccggaa cgcacgaaac ccttcgggtt
      721 ggagcgcggt ctcgaactgg agaaggtgca tcactgcttt aaagttcgcg ataaaacctt
      781 cttgttcgtc tcctggaagg gctgcgacga ggtggacgcc gtgcgcctgg aggagatcag
      841 gcaggcatac cccatcccaa tcataaagtt ctttgagggc ttgaaacttt ctgatcacta
      901 aggatgcctg gaaattcttg tcttgcataa taggctgaac aaatataatt ttttttcatt
      961 ttttttttaa attttcatac aagataatta ttattaaaaa agaaaaaggt catttaaaaa
     1021 tcgtactttt taaaaaagta aaagagaaac aagtcattta acaacaaaaa ttattaaaaa
     1081 tttaaattaa tcattatttt ctagtttcta gagttaatct aataaaagct ttatacttt