Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137332 1139 bp mRNA linear INV 09-DEC-2024 rhino-like (LOC108054397), mRNA. ACCESSION XM_017137332 VERSION XM_017137332.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137332.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1139 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1139 /gene="LOC108054397" /note="chromo domain-containing protein rhino-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054397" CDS 47..901 /gene="LOC108054397" /codon_start=1 /product="chromo domain-containing protein rhino-like" /protein_id="XP_016992821.2" /db_xref="GeneID:108054397" /translation="MSSGQPEKPCDSAAAEASATSAPDCNVYVVEKIVGKRLKGGRLQ YLVKWLGFSDEENTWEPLEGVIHCCDLLADFEAELLRRSQGQNAGGDQEQKQPQGATK KTRKSTKKPKRRHSSSVSREMEQPEAEVQAVINPPVKGKGKGNPKAPIPRRHSCSHLE SNADPVDLEMQRIHSSPVDMMPPQVGGHEDTPSKDDLPSSGEESIASEDGPDSWKMPE RTKPFGLERGLELEKVHHCFKVRDKTFLFVSWKGCDEVDAVRLEEIRQAYPIPIIKFF EGLKLSDH" misc_feature 128..277 /gene="LOC108054397" /note="CHROMO (CHRromatin Organization Modifier) domains and chromo shadow domains; Region: CD_CSD; cd00024" /db_xref="CDD:349274" misc_feature order(128..142,185..187,191..202,212..214,218..229, 233..238,257..259,266..271) /gene="LOC108054397" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:349274" misc_feature 731..877 /gene="LOC108054397" /note="chromo shadow domain; Region: CSD; cd00034" /db_xref="CDD:349275" misc_feature order(743..745,749..763,785..787,812..814,872..874) /gene="LOC108054397" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:349275" misc_feature order(761..763,776..778,827..832,851..856,860..865, 872..877) /gene="LOC108054397" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:349275" polyA_site 1139 /gene="LOC108054397" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgggtgcca ctcttttttc tttttttttt gtgtcgaaaa gaaaacatgt ctagtggaca 61 gccggaaaag ccctgtgact ccgcagccgc cgaagcatcc gcaaccagcg caccggactg 121 caatgtgtat gtggtggaga agatcgtggg caagcgcctg aagggcgggc gtcttcagta 181 cctggtgaag tggctgggct tctcggacga ggagaacacc tgggagccgc tggagggagt 241 gatccactgc tgcgatctgc tggccgactt cgaggcagag ctcttgcggc gcagccaggg 301 gcagaacgcc ggtggcgatc aggagcagaa gcagccgcag ggggcaacca agaagacccg 361 gaaatccacc aagaagccaa agcgcaggca ttcatcgagt gtttctcggg aaatggagca 421 gcccgaggcg gaagtccagg ctgtgatcaa tcctcctgtt aagggcaagg gcaagggcaa 481 tccaaaggct ccgatacccc gacgtcactc atgctctcat ctggagagca acgcagaccc 541 ggttgacttg gaaatgcagc gcatccacag ctcaccggtg gacatgatgc cgccgcaggt 601 cggtggccac gaggatacgc catccaaaga cgatctcccg agttccgggg aggagtcgat 661 cgcctcggag gacggtccag atagctggaa aatgccggaa cgcacgaaac ccttcgggtt 721 ggagcgcggt ctcgaactgg agaaggtgca tcactgcttt aaagttcgcg ataaaacctt 781 cttgttcgtc tcctggaagg gctgcgacga ggtggacgcc gtgcgcctgg aggagatcag 841 gcaggcatac cccatcccaa tcataaagtt ctttgagggc ttgaaacttt ctgatcacta 901 aggatgcctg gaaattcttg tcttgcataa taggctgaac aaatataatt ttttttcatt 961 ttttttttaa attttcatac aagataatta ttattaaaaa agaaaaaggt catttaaaaa 1021 tcgtactttt taaaaaagta aaagagaaac aagtcattta acaacaaaaa ttattaaaaa 1081 tttaaattaa tcattatttt ctagtttcta gagttaatct aataaaagct ttatacttt