Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Alanine-glyoxylate


LOCUS       XM_017137330            1424 bp    mRNA    linear   INV 09-DEC-2024
            aminotransferase (Agxt), transcript variant X1, mRNA.
ACCESSION   XM_017137330
VERSION     XM_017137330.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137330.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1424
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1424
                     /gene="Agxt"
                     /note="Alanine-glyoxylate aminotransferase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108054394"
     CDS             185..1369
                     /gene="Agxt"
                     /codon_start=1
                     /product="alanine--glyoxylate aminotransferase isoform X1"
                     /protein_id="XP_016992819.1"
                     /db_xref="GeneID:108054394"
                     /translation="MEVPPPLVLKRPLYVPSKTLMGPGPSNCSHRVLEAMSNPVLGHM
                     HPECLQIMDEVKEGIKYIFQTLNDATMCISGAGHSGMEAALCNLIEDGDVVLMGITGV
                     WGHRAGDMARRYGAEVHYVEASFGRALTLEEITFAFEAHRPRVFFIAQGDSSTGIYQQ
                     NIRELGELCRQYDCFLVVDTVASLGGAEFLMDEWKVDVAYTGSQKSLGGPAGITPISF
                     SKRALTRIRKRKSKPKVYYFDILLIGQYWGCYGTPRIYHHTISSTLLYGLREALAHFC
                     AVGLKAVVRRHQECSRRLQLGIEELGLEMFVQREEERLPTVNTIKVPFGVDWKKVAEY
                     AMRKYSVEISGGLGPTVEHVFRIGLMGENATVERVDMVLSILNEAIQSSKLGIKTERS
                     KI"
     misc_feature    239..1327
                     /gene="Agxt"
                     /note="Alanine-glyoxylate aminotransferase (AGAT) family.
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to alanine-glyoxylate
                     aminotransferase (AGAT); Region: AGAT_like; cd06451"
                     /db_xref="CDD:99744"
     misc_feature    order(281..283,290..292,311..313,317..319,407..412,
                     428..430,500..502,509..511,521..526,794..796,815..817,
                     893..895,956..967,1190..1192)
                     /gene="Agxt"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99744"
     misc_feature    order(410..418,491..493,641..643,719..721,725..727,
                     794..799)
                     /gene="Agxt"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99744"
     misc_feature    797..799
                     /gene="Agxt"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99744"
     polyA_site      1424
                     /gene="Agxt"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcagcgtttc agtcagatct tggccagcca gcgaggagga gcgaagaacc cgaggcccat
       61 atcatacaat ctaataacaa accccccgcc agacgaggtc cacctgttcc agcggattag
      121 gcgataagac agccataaac acagagatct ggttacgtaa acagaacaga attccgggaa
      181 taacatggag gtgccgccac cgctcgtcct caagcgacca ctttatgtgc ccagcaagac
      241 gctgatgggt cccgggccct ccaactgctc ccatcgcgtc ctggaggcca tgagcaaccc
      301 ggtcctgggc cacatgcatc ccgagtgcct gcagatcatg gacgaggtga aggagggcat
      361 caagtacatc ttccagaccc taaacgacgc caccatgtgc atcagtggag cgggtcattc
      421 cggaatggag gccgccctgt gcaatctgat cgaggacggc gatgtggtgc tcatgggcat
      481 cacgggagtc tggggtcatc gtgctgggga tatggcccgt cgctatggcg ccgaagtgca
      541 ttacgtggag gcgagtttcg gccgggctct aacgctcgag gagatcacat tcgccttcga
      601 agcgcatcgt ccgcgtgtct tcttcattgc ccaaggcgac tcatcgacgg gaatttacca
      661 gcagaatatc cgtgagctgg gcgagctgtg ccgccaatac gattgcttcc tagtcgtcga
      721 tacggtggcc tcgctgggcg gtgccgaatt tctgatggac gaatggaagg tggacgtggc
      781 ctatacgggc tcacagaaat ccctcggtgg tcccgccggc attacgccca tttcgtttag
      841 taagcgcgca ttaactcgca tccggaaaag gaaatccaag ccgaaggtct actattttga
      901 tatcctgctt atcggccagt actggggatg ctatggcacg ccgagaatct atcatcacac
      961 catttcctcc actctgctct acggtttgcg cgaggcactc gctcactttt gtgccgtggg
     1021 cctcaaggcg gtggtgcgac ggcatcagga gtgctcgcga cgattgcagc tgggcatcga
     1081 ggagcttgga ctggaaatgt tcgtccagcg ggaggaggaa cggctgccca cggtgaacac
     1141 aatcaaggtg ccgttcggcg tggactggaa aaaggtggcc gagtacgcca tgcgcaagta
     1201 cagcgtggag atcagcggcg gtctgggacc caccgtggag cacgtcttcc gcatcggttt
     1261 gatgggcgaa aatgccaccg tggagcgcgt ggacatggtt ctcagcatcc tcaacgaggc
     1321 catccagagc agcaagctgg gcatcaagac ggaacgatcc aaaatttaat gtagctcctt
     1381 gtttgtattg gtttttaaat aaaattttaa aattatcact tgaa