Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137330 1424 bp mRNA linear INV 09-DEC-2024 aminotransferase (Agxt), transcript variant X1, mRNA. ACCESSION XM_017137330 VERSION XM_017137330.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137330.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1424 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1424 /gene="Agxt" /note="Alanine-glyoxylate aminotransferase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108054394" CDS 185..1369 /gene="Agxt" /codon_start=1 /product="alanine--glyoxylate aminotransferase isoform X1" /protein_id="XP_016992819.1" /db_xref="GeneID:108054394" /translation="MEVPPPLVLKRPLYVPSKTLMGPGPSNCSHRVLEAMSNPVLGHM HPECLQIMDEVKEGIKYIFQTLNDATMCISGAGHSGMEAALCNLIEDGDVVLMGITGV WGHRAGDMARRYGAEVHYVEASFGRALTLEEITFAFEAHRPRVFFIAQGDSSTGIYQQ NIRELGELCRQYDCFLVVDTVASLGGAEFLMDEWKVDVAYTGSQKSLGGPAGITPISF SKRALTRIRKRKSKPKVYYFDILLIGQYWGCYGTPRIYHHTISSTLLYGLREALAHFC AVGLKAVVRRHQECSRRLQLGIEELGLEMFVQREEERLPTVNTIKVPFGVDWKKVAEY AMRKYSVEISGGLGPTVEHVFRIGLMGENATVERVDMVLSILNEAIQSSKLGIKTERS KI" misc_feature 239..1327 /gene="Agxt" /note="Alanine-glyoxylate aminotransferase (AGAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to alanine-glyoxylate aminotransferase (AGAT); Region: AGAT_like; cd06451" /db_xref="CDD:99744" misc_feature order(281..283,290..292,311..313,317..319,407..412, 428..430,500..502,509..511,521..526,794..796,815..817, 893..895,956..967,1190..1192) /gene="Agxt" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:99744" misc_feature order(410..418,491..493,641..643,719..721,725..727, 794..799) /gene="Agxt" /note="pyridoxal 5'-phosphate binding site [chemical binding]; other site" /db_xref="CDD:99744" misc_feature 797..799 /gene="Agxt" /note="catalytic residue [active]" /db_xref="CDD:99744" polyA_site 1424 /gene="Agxt" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcagcgtttc agtcagatct tggccagcca gcgaggagga gcgaagaacc cgaggcccat 61 atcatacaat ctaataacaa accccccgcc agacgaggtc cacctgttcc agcggattag 121 gcgataagac agccataaac acagagatct ggttacgtaa acagaacaga attccgggaa 181 taacatggag gtgccgccac cgctcgtcct caagcgacca ctttatgtgc ccagcaagac 241 gctgatgggt cccgggccct ccaactgctc ccatcgcgtc ctggaggcca tgagcaaccc 301 ggtcctgggc cacatgcatc ccgagtgcct gcagatcatg gacgaggtga aggagggcat 361 caagtacatc ttccagaccc taaacgacgc caccatgtgc atcagtggag cgggtcattc 421 cggaatggag gccgccctgt gcaatctgat cgaggacggc gatgtggtgc tcatgggcat 481 cacgggagtc tggggtcatc gtgctgggga tatggcccgt cgctatggcg ccgaagtgca 541 ttacgtggag gcgagtttcg gccgggctct aacgctcgag gagatcacat tcgccttcga 601 agcgcatcgt ccgcgtgtct tcttcattgc ccaaggcgac tcatcgacgg gaatttacca 661 gcagaatatc cgtgagctgg gcgagctgtg ccgccaatac gattgcttcc tagtcgtcga 721 tacggtggcc tcgctgggcg gtgccgaatt tctgatggac gaatggaagg tggacgtggc 781 ctatacgggc tcacagaaat ccctcggtgg tcccgccggc attacgccca tttcgtttag 841 taagcgcgca ttaactcgca tccggaaaag gaaatccaag ccgaaggtct actattttga 901 tatcctgctt atcggccagt actggggatg ctatggcacg ccgagaatct atcatcacac 961 catttcctcc actctgctct acggtttgcg cgaggcactc gctcactttt gtgccgtggg 1021 cctcaaggcg gtggtgcgac ggcatcagga gtgctcgcga cgattgcagc tgggcatcga 1081 ggagcttgga ctggaaatgt tcgtccagcg ggaggaggaa cggctgccca cggtgaacac 1141 aatcaaggtg ccgttcggcg tggactggaa aaaggtggcc gagtacgcca tgcgcaagta 1201 cagcgtggag atcagcggcg gtctgggacc caccgtggag cacgtcttcc gcatcggttt 1261 gatgggcgaa aatgccaccg tggagcgcgt ggacatggtt ctcagcatcc tcaacgaggc 1321 catccagagc agcaagctgg gcatcaagac ggaacgatcc aaaatttaat gtagctcctt 1381 gtttgtattg gtttttaaat aaaattttaa aattatcact tgaa