PREDICTED: Drosophila takahashii C-type lectin 37Db-like

LOCUS       XM_017137329             642 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054393), mRNA.
ACCESSION   XM_017137329
VERSION     XM_017137329.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017137329.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..642
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..642
                     /gene="LOC108054393"
                     /note="C-type lectin 37Db-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 17
                     Proteins"
                     /db_xref="GeneID:108054393"
     CDS             1..642
                     /gene="LOC108054393"
                     /codon_start=1
                     /product="C-type lectin 37Db-like"
                     /protein_id="XP_016992818.2"
                     /db_xref="GeneID:108054393"
                     /translation="MQSYFLWTLVVLALLGTSLVSGAKDADHLVCQLPEGSLQDLQEN
                     LEARLNGTEGQLQDIQNTLVSLQESLRTLLAEKENRNPEPAAIQNIPPKFERILDRYF
                     YIEHNLEVDWASAADICRKINGHLAALKNEEELAAIQLKLRNDWYHLGISDEGHKGEF
                     TSVASGKPAVFLKWNDESPENAGKCVQLKNGGFMGDYYCSERVNFICQLDTDV"
     misc_feature    301..624
                     /gene="LOC108054393"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(559..561,565..567,577..579,583..594,601..609)
                     /gene="LOC108054393"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgcaatcct atttcctctg gactctcgtt gtcctggcgc ttcttggcac ctcgttggta
       61 agcggcgcca aggatgctga ccatttggtt tgccaactgc ccgaaggatc gctgcaggat
      121 ctgcaggaga atctggaggc cagactgaac ggaacggagg gacagctgca ggacattcag
      181 aacaccttgg tctccctgca ggaatccctg aggacacttt tagccgagaa ggagaaccgg
      241 aacccggaac ccgctgccat ccaaaacatt ccgccgaagt tcgagcgaat cctcgatcgt
      301 tacttctata tagagcacaa tctcgaggtg gattgggctt cggctgccga catctgtcgc
      361 aagattaacg gccatttggc ggcgctgaag aacgaggagg agctggcggc catccaactg
      421 aagctgagga acgattggta tcacctgggg atcagcgatg agggtcacaa aggcgagttc
      481 acctccgtgg cctcgggtaa acccgctgta ttcctcaagt ggaacgatga gagtcccgaa
      541 aacgcaggaa agtgcgttca gcttaagaac ggcggcttta tgggagatta ttactgcagt
      601 gaacgagtca atttcatttg ccaattggac acagatgtat ag