Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137256 487 bp mRNA linear INV 09-DEC-2024 (LOC108054350), mRNA. ACCESSION XM_017137256 VERSION XM_017137256.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137256.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..487 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..487 /gene="LOC108054350" /note="uncharacterized LOC108054350; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108054350" CDS 77..400 /gene="LOC108054350" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016992745.3" /db_xref="GeneID:108054350" /translation="MESGKKQMTVSVIIESTWRLTIQRYAMGKRAPYKHLMDAVAEKF KLDLKDWEFVGPGGLCLETYDTAHLLEFADCHDILLKPLNDERSCEEAYEKRRIKLST EWETK" ORIGIN 1 ccaagagttt tgcatctcat caattgggct ggttgatttt catttttcat cagtcaatcg 61 aaagcgagca agagtaatgg agtcgggcaa gaagcaaatg accgttagcg tgattataga 121 gagtacctgg cgtttgacaa ttcaacggta tgcaatgggc aagagagcgc catataaaca 181 cctgatggat gcggttgccg aaaagttcaa attggacctc aaagattggg agtttgtggg 241 acccggcgga ctgtgccttg agacatacga tacggcacac ttactggaat tcgccgactg 301 ccatgacata ttgctcaaac cattaaatga tgaacgcagc tgcgaggaag catatgaaaa 361 aaggcgcata aaattaagca cagaatggga aaccaagtga aaaaagaatt caaatatcaa 421 ttctgaaata aaattcagtg gcgctggcta attgagcgtc attttacctc agaaaaaatt 481 aaggatt