Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH dehydrogenase (ubiquinone)


LOCUS       XM_017137159             698 bp    mRNA    linear   INV 09-DEC-2024
            B18 subunit (ND-B18), mRNA.
ACCESSION   XM_017137159
VERSION     XM_017137159.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137159.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..698
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..698
                     /gene="ND-B18"
                     /note="NADH dehydrogenase (ubiquinone) B18 subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108054279"
     CDS             183..536
                     /gene="ND-B18"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 beta
                     subcomplex subunit 7"
                     /protein_id="XP_016992648.2"
                     /db_xref="GeneID:108054279"
                     /translation="MGNALTHYLKPDVMPGPDVVTTFDPMLGFESRKERVMVATQEEM
                     ESAKLPLDARDYCAHLAIAYQACRTDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEFER
                     ERRLLERQKRLNKAA"
     misc_feature    297..482
                     /gene="ND-B18"
                     /note="NADH-ubiquinone oxidoreductase B18 subunit
                     (NDUFB7); Region: NDUF_B7; pfam05676"
                     /db_xref="CDD:461710"
     polyA_site      698
                     /gene="ND-B18"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacacgtcaa acggcaattt gcaacctcca gctgtttttc gtacagtgct gtaaaacacc
       61 ggcgcaccgc gagctggcaa ccctggccag cagctgtcac ttgcaacaac aacaacgggg
      121 ggcaggaaga agaagacttt gacagctgcg ccgcaaccga aatcgaagaa aaacatttta
      181 cgatgggcaa cgcgctgacg cactacctga agccggacgt gatgcccggg cccgatgtgg
      241 tgaccacctt tgacccaatg ctgggcttcg aatcgcgcaa ggagcgcgtg atggtcgcca
      301 cccaggagga gatggagtcc gccaagctgc cgctggacgc ccgcgactac tgcgcccatt
      361 tggccatcgc ctaccaggcc tgccgcacgg acaccttccc gttcgtgtac aagtgcgccc
      421 accagaagca cgagtacctc acctgcgagt acgaggacta cgtgctccgc atgaaggagt
      481 tcgagcggga gcgccggctg ctggagcgcc agaagcgcct gaacaaggcc gcctaggcta
      541 agctagatac tcctaccccc ctctacaacc ccctacacac aaccaggaga cgcccctggc
      601 cgcgcggatc cactgccact gccccatgtt gcaagctagt ttccagcgga ataatgtcaa
      661 taaacaactc catgctagta ataatgcgga tctgctaa