Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017137142             651 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054269), mRNA.
ACCESSION   XM_017137142
VERSION     XM_017137142.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137142.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..651
                     /gene="LOC108054269"
                     /note="uncharacterized LOC108054269; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108054269"
     CDS             111..560
                     /gene="LOC108054269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016992631.2"
                     /db_xref="GeneID:108054269"
                     /translation="MYSPHIALMSAVQANDSRHEAKLRFQRHPKENVYTDPRLEQLIV
                     YRALLEHLMEQKSHYDHERELEVQRLERFRCEGANERRLQVQEQVVKKAQGMLPGIVF
                     KMRNEVDKLKRFLDGDKEQEMRQLDNALYDHCSDLLKNCQVTLDNLH"
     misc_feature    219..476
                     /gene="LOC108054269"
                     /note="Tubulin binding cofactor A; Region: TBCA;
                     pfam02970"
                     /db_xref="CDD:460769"
ORIGIN      
        1 tcgaaacttg gtttgtccta gcctgactcc cattcgaata actctcactc actcgcccga
       61 gtttgtcgcc tatatatttc ccccagtcga gctgttggtc gcttagagcc atgtacagtc
      121 cgcacatcgc ccttatgtcg gccgtgcagg ccaacgacag tcgtcacgag gccaagctgc
      181 gattccagcg ccatcccaag gagaacgtct acacggatcc gcgtctggag caactgatcg
      241 tctaccgggc cctgctggag cacctgatgg agcagaagtc tcactacgat cacgagcggg
      301 agctggaggt ccagcgtctc gagcgcttcc gctgcgaggg agccaacgag cggcggctgc
      361 aggtgcagga gcaggtggtg aagaaggccc agggcatgct gcccggtatc gttttcaaga
      421 tgcgcaacga ggtggacaag ctgaagcgct tcctcgacgg cgacaaggag caggagatgc
      481 ggcaactgga caacgctctc tacgaccact gcagcgatct cctcaagaac tgccaggtta
      541 ccctggacaa cctgcattga actgcctaac caaattttat cattcaaatt acattgtgcc
      601 acaccaaaaa aaaaagccca aagcctatca aataatcacc tgcgaaaaat g