Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137142 651 bp mRNA linear INV 09-DEC-2024 (LOC108054269), mRNA. ACCESSION XM_017137142 VERSION XM_017137142.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137142.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..651 /gene="LOC108054269" /note="uncharacterized LOC108054269; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054269" CDS 111..560 /gene="LOC108054269" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016992631.2" /db_xref="GeneID:108054269" /translation="MYSPHIALMSAVQANDSRHEAKLRFQRHPKENVYTDPRLEQLIV YRALLEHLMEQKSHYDHERELEVQRLERFRCEGANERRLQVQEQVVKKAQGMLPGIVF KMRNEVDKLKRFLDGDKEQEMRQLDNALYDHCSDLLKNCQVTLDNLH" misc_feature 219..476 /gene="LOC108054269" /note="Tubulin binding cofactor A; Region: TBCA; pfam02970" /db_xref="CDD:460769" ORIGIN 1 tcgaaacttg gtttgtccta gcctgactcc cattcgaata actctcactc actcgcccga 61 gtttgtcgcc tatatatttc ccccagtcga gctgttggtc gcttagagcc atgtacagtc 121 cgcacatcgc ccttatgtcg gccgtgcagg ccaacgacag tcgtcacgag gccaagctgc 181 gattccagcg ccatcccaag gagaacgtct acacggatcc gcgtctggag caactgatcg 241 tctaccgggc cctgctggag cacctgatgg agcagaagtc tcactacgat cacgagcggg 301 agctggaggt ccagcgtctc gagcgcttcc gctgcgaggg agccaacgag cggcggctgc 361 aggtgcagga gcaggtggtg aagaaggccc agggcatgct gcccggtatc gttttcaaga 421 tgcgcaacga ggtggacaag ctgaagcgct tcctcgacgg cgacaaggag caggagatgc 481 ggcaactgga caacgctctc tacgaccact gcagcgatct cctcaagaac tgccaggtta 541 ccctggacaa cctgcattga actgcctaac caaattttat cattcaaatt acattgtgcc 601 acaccaaaaa aaaaagccca aagcctatca aataatcacc tgcgaaaaat g