Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii microsomal glutathione


LOCUS       XM_017137136            1279 bp    mRNA    linear   INV 09-DEC-2024
            S-transferase 1 (LOC108054265), mRNA.
ACCESSION   XM_017137136
VERSION     XM_017137136.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137136.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1279
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1279
                     /gene="LOC108054265"
                     /note="microsomal glutathione S-transferase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:108054265"
     CDS             680..1183
                     /gene="LOC108054265"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1"
                     /protein_id="XP_016992625.1"
                     /db_xref="GeneID:108054265"
                     /translation="MDSGPTDATPTAAAFRLVLLSKSNPVMGCYMFWASLLVLKMLLM
                     SLLTARQRMKTKTFANPEDLRISRSPEVRFGDPNVERVRRAHRNDLENILPFLLMSLV
                     YVASGPNPLTARLLIRIGASARLLHTVVYAVIPVPQPARALTFFTTFAITCFEAGYVL
                     IRCIKYI"
     misc_feature    767..1162
                     /gene="LOC108054265"
                     /note="MAPEG family; Region: MAPEG; pfam01124"
                     /db_xref="CDD:460074"
ORIGIN      
        1 catgtttcga gtttgagtgg gtctccatta agcggcagac atctaatcag acggagaatt
       61 gcctcgtttc aattcatttt cgtctggctg aaagacgctg acaaactgaa gaccgcacaa
      121 gcacacgcac atggttattt taggtctgct ggctccatct acctttgaag tactaagaca
      181 aaaggccctc tatatttaaa tatacaaact ctttgggtgt atgaattcgc tagatatggt
      241 aggtgtcctc gctaactgcc actgcacagt ggggaaaaat ggttactttt tggaataaac
      301 taaaattata gtttatatta taataatgaa gacaataccg aaaattcaga atatatgcca
      361 aataaagcat aataatattt atattacttg caattgagca aaaaattgga catcgatttt
      421 tggaagactt aataacgact attatatcta atgaattatg aattcgcgaa atgcacttaa
      481 aaatcagcta gaaatagccc gaaatgagcg ctgaaagggg agaacttccc ttaaattatt
      541 gagtaattat agatttgaac gtggaaatgg ggtcagttga gggaaccgct ccacctgttg
      601 tgcctcctcc gccaatcggc ctcctggcgg acttaatcac ctgcgaaccg tcgacagtaa
      661 aggtaacgaa actttcatta tggacagcgg acccactgat gccacgccca ccgccgccgc
      721 cttccggctg gtgctgctca gcaaatcgaa tcccgtgatg ggctgctaca tgttctgggc
      781 cagtctgctg gtcctcaaga tgctcctcat gtcgctgctc acggcccgcc agcggatgaa
      841 gaccaagacc tttgccaatc cggaggattt gcgcatcagc cggagtccgg aggtgcgatt
      901 cggggatccc aatgtggagc gagtgcgacg ggcccatcgc aacgacttgg agaacattct
      961 gcccttcctc ctgatgtcgc tggtctacgt ggccagcgga ccgaatcccc tgaccgcccg
     1021 tctgctcatc cgcatcggag ccagcgcccg gctgctccac acggtggtct acgccgtaat
     1081 cccggttccg caaccggcca gagccctgac cttcttcacc accttcgcga ttacctgctt
     1141 cgaggcgggc tacgtactca tccgctgtat caagtacatt tagaccttac acttagtcag
     1201 ctaactagtc accctttttt agcataatta accgcaccag tgatgtcgga tttaaaggtc
     1261 taggtacaga tttaggtac