Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137136 1279 bp mRNA linear INV 09-DEC-2024 S-transferase 1 (LOC108054265), mRNA. ACCESSION XM_017137136 VERSION XM_017137136.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137136.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1279 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1279 /gene="LOC108054265" /note="microsomal glutathione S-transferase 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:108054265" CDS 680..1183 /gene="LOC108054265" /codon_start=1 /product="microsomal glutathione S-transferase 1" /protein_id="XP_016992625.1" /db_xref="GeneID:108054265" /translation="MDSGPTDATPTAAAFRLVLLSKSNPVMGCYMFWASLLVLKMLLM SLLTARQRMKTKTFANPEDLRISRSPEVRFGDPNVERVRRAHRNDLENILPFLLMSLV YVASGPNPLTARLLIRIGASARLLHTVVYAVIPVPQPARALTFFTTFAITCFEAGYVL IRCIKYI" misc_feature 767..1162 /gene="LOC108054265" /note="MAPEG family; Region: MAPEG; pfam01124" /db_xref="CDD:460074" ORIGIN 1 catgtttcga gtttgagtgg gtctccatta agcggcagac atctaatcag acggagaatt 61 gcctcgtttc aattcatttt cgtctggctg aaagacgctg acaaactgaa gaccgcacaa 121 gcacacgcac atggttattt taggtctgct ggctccatct acctttgaag tactaagaca 181 aaaggccctc tatatttaaa tatacaaact ctttgggtgt atgaattcgc tagatatggt 241 aggtgtcctc gctaactgcc actgcacagt ggggaaaaat ggttactttt tggaataaac 301 taaaattata gtttatatta taataatgaa gacaataccg aaaattcaga atatatgcca 361 aataaagcat aataatattt atattacttg caattgagca aaaaattgga catcgatttt 421 tggaagactt aataacgact attatatcta atgaattatg aattcgcgaa atgcacttaa 481 aaatcagcta gaaatagccc gaaatgagcg ctgaaagggg agaacttccc ttaaattatt 541 gagtaattat agatttgaac gtggaaatgg ggtcagttga gggaaccgct ccacctgttg 601 tgcctcctcc gccaatcggc ctcctggcgg acttaatcac ctgcgaaccg tcgacagtaa 661 aggtaacgaa actttcatta tggacagcgg acccactgat gccacgccca ccgccgccgc 721 cttccggctg gtgctgctca gcaaatcgaa tcccgtgatg ggctgctaca tgttctgggc 781 cagtctgctg gtcctcaaga tgctcctcat gtcgctgctc acggcccgcc agcggatgaa 841 gaccaagacc tttgccaatc cggaggattt gcgcatcagc cggagtccgg aggtgcgatt 901 cggggatccc aatgtggagc gagtgcgacg ggcccatcgc aacgacttgg agaacattct 961 gcccttcctc ctgatgtcgc tggtctacgt ggccagcgga ccgaatcccc tgaccgcccg 1021 tctgctcatc cgcatcggag ccagcgcccg gctgctccac acggtggtct acgccgtaat 1081 cccggttccg caaccggcca gagccctgac cttcttcacc accttcgcga ttacctgctt 1141 cgaggcgggc tacgtactca tccgctgtat caagtacatt tagaccttac acttagtcag 1201 ctaactagtc accctttttt agcataatta accgcaccag tgatgtcgga tttaaaggtc 1261 taggtacaga tttaggtac