Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cytochrome c oxidase copper


LOCUS       XM_017137134             550 bp    mRNA    linear   INV 09-DEC-2024
            chaperone COX17 (Cox17), mRNA.
ACCESSION   XM_017137134
VERSION     XM_017137134.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137134.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..550
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..550
                     /gene="Cox17"
                     /note="Cytochrome c oxidase copper chaperone COX17;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108054264"
     CDS             140..385
                     /gene="Cox17"
                     /codon_start=1
                     /product="cytochrome c oxidase copper chaperone"
                     /protein_id="XP_016992623.1"
                     /db_xref="GeneID:108054264"
                     /translation="MGNSASQGVAAPSVSAAQPVATASSAAAGTASSEKPKCKACCAC
                     PETKRARDACIVENGEENCSALIEAHKKCMRDAGFNI"
     misc_feature    245..382
                     /gene="Cox17"
                     /note="Cytochrome C oxidase copper chaperone (COX17);
                     Region: COX17; pfam05051"
                     /db_xref="CDD:428283"
     polyA_site      550
                     /gene="Cox17"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagcacccat ctcgatagtt gtcattattt gacaaccctg ttcggtgaac ttgaatttag
       61 ttattttcgt gtgcgccgat aaatcggatt gtggtgaaat atccgtctcg aaacttgttg
      121 accacaaacc gcttgaagaa tgggcaacag cgcgtcccag ggagtcgcag ctcccagtgt
      181 ttcggccgcc cagccggtgg ccaccgcctc ctccgccgcc gcgggaaccg cctcctccga
      241 gaagcccaag tgcaaggcct gttgcgcctg tccggagacc aagagggcac gtgacgcctg
      301 cattgtggag aacggcgagg agaactgctc ggcgctcatc gaggcgcaca agaagtgcat
      361 gcgcgatgcc ggcttcaata tctagaatct ggatatctgg atatccagat actctggatc
      421 ggagggccat ggtgtccttt caactagtcc tgcagacccc cagttcatca cccggacacc
      481 ctgatccttc cactgtttgt ttttgttgca tctcaagcta attatagaac taaattaact
      541 gaaagccaaa