Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137134 550 bp mRNA linear INV 09-DEC-2024 chaperone COX17 (Cox17), mRNA. ACCESSION XM_017137134 VERSION XM_017137134.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137134.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..550 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..550 /gene="Cox17" /note="Cytochrome c oxidase copper chaperone COX17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054264" CDS 140..385 /gene="Cox17" /codon_start=1 /product="cytochrome c oxidase copper chaperone" /protein_id="XP_016992623.1" /db_xref="GeneID:108054264" /translation="MGNSASQGVAAPSVSAAQPVATASSAAAGTASSEKPKCKACCAC PETKRARDACIVENGEENCSALIEAHKKCMRDAGFNI" misc_feature 245..382 /gene="Cox17" /note="Cytochrome C oxidase copper chaperone (COX17); Region: COX17; pfam05051" /db_xref="CDD:428283" polyA_site 550 /gene="Cox17" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagcacccat ctcgatagtt gtcattattt gacaaccctg ttcggtgaac ttgaatttag 61 ttattttcgt gtgcgccgat aaatcggatt gtggtgaaat atccgtctcg aaacttgttg 121 accacaaacc gcttgaagaa tgggcaacag cgcgtcccag ggagtcgcag ctcccagtgt 181 ttcggccgcc cagccggtgg ccaccgcctc ctccgccgcc gcgggaaccg cctcctccga 241 gaagcccaag tgcaaggcct gttgcgcctg tccggagacc aagagggcac gtgacgcctg 301 cattgtggag aacggcgagg agaactgctc ggcgctcatc gaggcgcaca agaagtgcat 361 gcgcgatgcc ggcttcaata tctagaatct ggatatctgg atatccagat actctggatc 421 ggagggccat ggtgtccttt caactagtcc tgcagacccc cagttcatca cccggacacc 481 ctgatccttc cactgtttgt ttttgttgca tctcaagcta attatagaac taaattaact 541 gaaagccaaa