Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii microsomal glutathione


LOCUS       XM_017137132             807 bp    mRNA    linear   INV 09-DEC-2024
            S-transferase 1 (LOC108054263), transcript variant X2, mRNA.
ACCESSION   XM_017137132
VERSION     XM_017137132.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137132.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..807
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..807
                     /gene="LOC108054263"
                     /note="microsomal glutathione S-transferase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins"
                     /db_xref="GeneID:108054263"
     CDS             291..779
                     /gene="LOC108054263"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1 isoform
                     X2"
                     /protein_id="XP_016992621.3"
                     /db_xref="GeneID:108054263"
                     /translation="MSSPQSSNNTTTGDMFTLENRVFCCYLFWATVLVAKMLLMSLLT
                     AVQRFRYKVFPNQEDLFFKNLEVQFNDPNVERVRRAHRNDMENILPYFIMSLIYISTN
                     PNAVVACNLFRVASVARIIHTLVYAVYPVPQPSRILAFATMLLITFYMAAVVALRTLS
                     FI"
     misc_feature    366..758
                     /gene="LOC108054263"
                     /note="MAPEG family; Region: MAPEG; pfam01124"
                     /db_xref="CDD:460074"
     polyA_site      807
                     /gene="LOC108054263"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taactaatta tttattacaa atcatataaa ttcgaaattt aaggattttt ttctctatat
       61 agaggtagtt tgaaataata gtgtaccaca gcttagctac cccgaaatgg gtaaaataga
      121 gttattgctg cacagcacct tggatattcg gttcgacgca attcgtaacc agtttggtcg
      181 catgtctatg atctccgcat tgagtgctga ttgctgagtg ctgctgcgag ttaatcattc
      241 ggcgaagtcg cctcaaagtg aacgcacata cagcacattc cgcatccgcc atgtcgtccc
      301 cacaaagttc aaataatacg accaccggcg atatgttcac cctggagaat cgcgtctttt
      361 gctgctacct cttttgggcc actgtgctgg tggccaagat gctgctcatg tcgctgctga
      421 cggccgtcca gcgtttccgc tataaggtct ttcccaacca ggaggatctg ttcttcaaga
      481 acctcgaggt gcaattcaat gatccgaatg tggagcgggt tagaagagcc catcgcaatg
      541 acatggagaa catcctgccg tacttcatca tgtccctgat ctacatcagc accaatccga
      601 atgccgttgt ggcctgcaat ctgttccgag tggcctccgt ggccaggatc atccacaccc
      661 tggtctacgc cgtctatccg gtgccgcagc cttcgaggat cctggccttc gccaccatgc
      721 tcctgatcac cttctacatg gccgccgtgg tggccctgcg cacccttagc tttatctaaa
      781 taaactgtag tgactatcgg cttaaaa