Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017136850 653 bp mRNA linear INV 09-DEC-2024 UDP-N-acetylglucosaminyltransferase subunit (Alg14), mRNA. ACCESSION XM_017136850 VERSION XM_017136850.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017136850.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..653 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..653 /gene="Alg14" /note="ALG14, UDP-N-acetylglucosaminyltransferase subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054090" CDS 52..615 /gene="Alg14" /codon_start=1 /product="UDP-N-acetylglucosamine transferase subunit ALG14" /protein_id="XP_016992339.2" /db_xref="GeneID:108054090" /translation="MPHPTYVILGSGGHTAEMCRLARALLQPADNQRAEEYHPVRLIL ASSDSTSERQFREALPEVASRAECIRVPRSRSVGQSWLSTLFTALWSLLFSCYLVWRD RPQLILCNGPGTCVPFCYAAWMWRLLGRLPAHSRIVFVESFCRVETLSLSGRLLLPLA DLFVVHWPQLAERYEERRNLRYFGRIL" misc_feature 64..609 /gene="Alg14" /note="Oligosaccharide biosynthesis protein Alg14 like; Region: Alg14; pfam08660" /db_xref="CDD:370045" ORIGIN 1 atcgccttgg gatgtaaaca aagttatcac tttgaatttc tggcgaggat catgccgcat 61 cccacctacg tgatcctggg ctccggcggc cacaccgccg agatgtgccg tctcgcccgg 121 gcgctgctcc agccggcgga caaccagcgg gcggaggaat accaccctgt gcgcctaatc 181 ctcgccagca gcgattccac atcggagcgg cagttcaggg aggccctgcc ggaggtggct 241 tcgcgggcgg agtgcatccg cgtgccccgc agccgcagcg ttggccaatc ctggctgagc 301 accctgttca ccgccctgtg gtcgctcctc ttcagttgct acctcgtttg gcgcgaccgc 361 ccgcagttga tcctgtgcaa tggacccggc acctgtgtgc ccttctgcta tgccgcctgg 421 atgtggcgcc tcctgggccg cctgcccgcc cactcgagga ttgttttcgt ggagagcttc 481 tgtcgcgtgg agacgctttc gctgagtgga aggctgctcc tgccgctggc cgatctcttc 541 gtggtccact ggccgcagct ggcggagcgc tatgaggaga ggcggaatct acgctatttc 601 ggtcgcattt tgtaacatta tttaatcagt tagaaaacaa agaatgataa att