Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ALG14,


LOCUS       XM_017136850             653 bp    mRNA    linear   INV 09-DEC-2024
            UDP-N-acetylglucosaminyltransferase subunit (Alg14), mRNA.
ACCESSION   XM_017136850
VERSION     XM_017136850.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017136850.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..653
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..653
                     /gene="Alg14"
                     /note="ALG14, UDP-N-acetylglucosaminyltransferase subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108054090"
     CDS             52..615
                     /gene="Alg14"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG14"
                     /protein_id="XP_016992339.2"
                     /db_xref="GeneID:108054090"
                     /translation="MPHPTYVILGSGGHTAEMCRLARALLQPADNQRAEEYHPVRLIL
                     ASSDSTSERQFREALPEVASRAECIRVPRSRSVGQSWLSTLFTALWSLLFSCYLVWRD
                     RPQLILCNGPGTCVPFCYAAWMWRLLGRLPAHSRIVFVESFCRVETLSLSGRLLLPLA
                     DLFVVHWPQLAERYEERRNLRYFGRIL"
     misc_feature    64..609
                     /gene="Alg14"
                     /note="Oligosaccharide biosynthesis protein Alg14 like;
                     Region: Alg14; pfam08660"
                     /db_xref="CDD:370045"
ORIGIN      
        1 atcgccttgg gatgtaaaca aagttatcac tttgaatttc tggcgaggat catgccgcat
       61 cccacctacg tgatcctggg ctccggcggc cacaccgccg agatgtgccg tctcgcccgg
      121 gcgctgctcc agccggcgga caaccagcgg gcggaggaat accaccctgt gcgcctaatc
      181 ctcgccagca gcgattccac atcggagcgg cagttcaggg aggccctgcc ggaggtggct
      241 tcgcgggcgg agtgcatccg cgtgccccgc agccgcagcg ttggccaatc ctggctgagc
      301 accctgttca ccgccctgtg gtcgctcctc ttcagttgct acctcgtttg gcgcgaccgc
      361 ccgcagttga tcctgtgcaa tggacccggc acctgtgtgc ccttctgcta tgccgcctgg
      421 atgtggcgcc tcctgggccg cctgcccgcc cactcgagga ttgttttcgt ggagagcttc
      481 tgtcgcgtgg agacgctttc gctgagtgga aggctgctcc tgccgctggc cgatctcttc
      541 gtggtccact ggccgcagct ggcggagcgc tatgaggaga ggcggaatct acgctatttc
      601 ggtcgcattt tgtaacatta tttaatcagt tagaaaacaa agaatgataa att