Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017136834 829 bp mRNA linear INV 09-DEC-2024 (LOC108054082), mRNA. ACCESSION XM_017136834 VERSION XM_017136834.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017136834.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..829 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..829 /gene="LOC108054082" /note="transmembrane protein 17B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054082" CDS 293..829 /gene="LOC108054082" /codon_start=1 /product="transmembrane protein 17B" /protein_id="XP_016992323.2" /db_xref="GeneID:108054082" /translation="MSHSVSPHRANLLLQMLLQANTYVSMVWAMSYMIHMLIRLNNLW NLEGLSMLMAYILAISAESVRLYAGYSVNLCSGATAMWLLLTVTPCILLPAMVFLRLS AAGRSLWLRIITNAVFGLIALEVIVCLVHFVICKPGKRMSRMSQGEKEQEQEEPGESE DEEDDLSSSEEELKLKSK" misc_feature 338..655 /gene="LOC108054082" /note="Predicted membrane protein; Region: Transmemb_17; pfam09799" /db_xref="CDD:462907" ORIGIN 1 tttatttgta aaatactgat taatattcaa atccgctgac ttggcgccag gaccttttgt 61 tggagtgcca aagcagccag cttgtgtctg accatcgcag gacctgtcag gacttctcgc 121 atcactcagg aaggagacgt cgcttccagc tgattacgtt gccgttggtt accacgacca 181 ccagcgaaaa gtacaacaat cgaagctgct ggaagtggca gctatttcag tgcaagattt 241 ccatcatccc aagcaaaaag tggattacaa ggacatcgaa aaagtagcaa aaatgtcgca 301 ctcagtgtcg ccacatcggg ccaacctgct gctccagatg ctcctacagg cgaataccta 361 tgtgtccatg gtgtgggcca tgagctacat gatccacatg ctcatccggc taaataactt 421 gtggaatttg gagggcctat ccatgctgat ggcctacatc ctggccattt ccgccgaatc 481 cgtgcgcctg tacgccggct actcggtgaa cctgtgctcc ggggccaccg ccatgtggct 541 gctgctcacg gtgacgccct gcatcctgct gcccgccatg gtcttcctgc gcctctcggc 601 cgccggacga agtctctggc tgcgcatcat cacgaatgcc gtctttggtt tgattgccct 661 ggaggtgatt gtgtgcctgg ttcactttgt gatctgcaag ccgggcaagc gaatgtctag 721 gatgtcccaa ggggaaaagg aacaggaaca agaggaacca ggggaatcag aggatgagga 781 ggatgatctg tcgtcgtcgg aggaggagct aaagctcaag tccaagtga