Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii transmembrane protein 17B


LOCUS       XM_017136834             829 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054082), mRNA.
ACCESSION   XM_017136834
VERSION     XM_017136834.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017136834.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..829
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..829
                     /gene="LOC108054082"
                     /note="transmembrane protein 17B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108054082"
     CDS             293..829
                     /gene="LOC108054082"
                     /codon_start=1
                     /product="transmembrane protein 17B"
                     /protein_id="XP_016992323.2"
                     /db_xref="GeneID:108054082"
                     /translation="MSHSVSPHRANLLLQMLLQANTYVSMVWAMSYMIHMLIRLNNLW
                     NLEGLSMLMAYILAISAESVRLYAGYSVNLCSGATAMWLLLTVTPCILLPAMVFLRLS
                     AAGRSLWLRIITNAVFGLIALEVIVCLVHFVICKPGKRMSRMSQGEKEQEQEEPGESE
                     DEEDDLSSSEEELKLKSK"
     misc_feature    338..655
                     /gene="LOC108054082"
                     /note="Predicted membrane protein; Region: Transmemb_17;
                     pfam09799"
                     /db_xref="CDD:462907"
ORIGIN      
        1 tttatttgta aaatactgat taatattcaa atccgctgac ttggcgccag gaccttttgt
       61 tggagtgcca aagcagccag cttgtgtctg accatcgcag gacctgtcag gacttctcgc
      121 atcactcagg aaggagacgt cgcttccagc tgattacgtt gccgttggtt accacgacca
      181 ccagcgaaaa gtacaacaat cgaagctgct ggaagtggca gctatttcag tgcaagattt
      241 ccatcatccc aagcaaaaag tggattacaa ggacatcgaa aaagtagcaa aaatgtcgca
      301 ctcagtgtcg ccacatcggg ccaacctgct gctccagatg ctcctacagg cgaataccta
      361 tgtgtccatg gtgtgggcca tgagctacat gatccacatg ctcatccggc taaataactt
      421 gtggaatttg gagggcctat ccatgctgat ggcctacatc ctggccattt ccgccgaatc
      481 cgtgcgcctg tacgccggct actcggtgaa cctgtgctcc ggggccaccg ccatgtggct
      541 gctgctcacg gtgacgccct gcatcctgct gcccgccatg gtcttcctgc gcctctcggc
      601 cgccggacga agtctctggc tgcgcatcat cacgaatgcc gtctttggtt tgattgccct
      661 ggaggtgatt gtgtgcctgg ttcactttgt gatctgcaag ccgggcaagc gaatgtctag
      721 gatgtcccaa ggggaaaagg aacaggaaca agaggaacca ggggaatcag aggatgagga
      781 ggatgatctg tcgtcgtcgg aggaggagct aaagctcaag tccaagtga