Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017136833 734 bp mRNA linear INV 09-DEC-2024 (LOC108054081), mRNA. ACCESSION XM_017136833 VERSION XM_017136833.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017136833.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..734 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..734 /gene="LOC108054081" /note="glycolipid transfer protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054081" CDS 16..624 /gene="LOC108054081" /codon_start=1 /product="glycolipid transfer protein" /protein_id="XP_016992322.1" /db_xref="GeneID:108054081" /translation="MAATEGSARIQFKALKGFPAIGTDKLETQAFLAASKEIVTVIES FGKLFTPVISDMNGNINKLTKAYGADVLKYQYLEDLIVLNVNVDDFAANALLWLKRGL QLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLL GQGAAQVENMEVLTSFLPTMRAHLDSIDALLRAHNLDDARKV" misc_feature 91..495 /gene="LOC108054081" /note="Glycolipid transfer protein (GLTP); Region: GLTP; pfam08718" /db_xref="CDD:462575" polyA_site 734 /gene="LOC108054081" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaatatagc agacaatggc agccaccgag ggatccgcgc gaattcagtt caaggcgctg 61 aagggatttc cagcaatcgg cactgataag ctggagacac aggccttcct cgccgcctcc 121 aaggagatag taaccgtcat agagagcttc ggcaaactgt ttacgcccgt gatcagcgac 181 atgaacggaa acataaacaa attaacgaaa gcctacgggg cggatgtgtt gaagtaccaa 241 tatctggagg atctgatcgt gctgaatgtg aacgtggacg attttgcggc caacgcgctg 301 ctctggctaa agcgcggcct ccagctgatt tgcaccttct tcgagaacat ctacaacgat 361 gcccaggcca aggaggcact gaagcagcac ctgcaggacg cctacgagcg caccttgaag 421 ccctatcacg gcttcatagt ccagagcaca ataaagatca tctacagctg ggtgcccacg 481 cgcagccagc tgctgggcca gggagccgcc caggtggaga acatggaggt gctgaccagc 541 ttcctgccca cgatgcgtgc ccatttggac tcgatcgatg cccttttgag ggcccacaat 601 ctggacgatg cccgaaaggt gtgatttaga tcgcgatgga gaacgtttcc ttagcttagc 661 ctagcttaaa tagcttatcc tactttatta tttatgccaa tgttgcgaag taaacctcag 721 agccttacta aaaa