Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii glycolipid transfer protein


LOCUS       XM_017136833             734 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054081), mRNA.
ACCESSION   XM_017136833
VERSION     XM_017136833.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017136833.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..734
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..734
                     /gene="LOC108054081"
                     /note="glycolipid transfer protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054081"
     CDS             16..624
                     /gene="LOC108054081"
                     /codon_start=1
                     /product="glycolipid transfer protein"
                     /protein_id="XP_016992322.1"
                     /db_xref="GeneID:108054081"
                     /translation="MAATEGSARIQFKALKGFPAIGTDKLETQAFLAASKEIVTVIES
                     FGKLFTPVISDMNGNINKLTKAYGADVLKYQYLEDLIVLNVNVDDFAANALLWLKRGL
                     QLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLL
                     GQGAAQVENMEVLTSFLPTMRAHLDSIDALLRAHNLDDARKV"
     misc_feature    91..495
                     /gene="LOC108054081"
                     /note="Glycolipid transfer protein (GLTP); Region: GLTP;
                     pfam08718"
                     /db_xref="CDD:462575"
     polyA_site      734
                     /gene="LOC108054081"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaatatagc agacaatggc agccaccgag ggatccgcgc gaattcagtt caaggcgctg
       61 aagggatttc cagcaatcgg cactgataag ctggagacac aggccttcct cgccgcctcc
      121 aaggagatag taaccgtcat agagagcttc ggcaaactgt ttacgcccgt gatcagcgac
      181 atgaacggaa acataaacaa attaacgaaa gcctacgggg cggatgtgtt gaagtaccaa
      241 tatctggagg atctgatcgt gctgaatgtg aacgtggacg attttgcggc caacgcgctg
      301 ctctggctaa agcgcggcct ccagctgatt tgcaccttct tcgagaacat ctacaacgat
      361 gcccaggcca aggaggcact gaagcagcac ctgcaggacg cctacgagcg caccttgaag
      421 ccctatcacg gcttcatagt ccagagcaca ataaagatca tctacagctg ggtgcccacg
      481 cgcagccagc tgctgggcca gggagccgcc caggtggaga acatggaggt gctgaccagc
      541 ttcctgccca cgatgcgtgc ccatttggac tcgatcgatg cccttttgag ggcccacaat
      601 ctggacgatg cccgaaaggt gtgatttaga tcgcgatgga gaacgtttcc ttagcttagc
      661 ctagcttaaa tagcttatcc tactttatta tttatgccaa tgttgcgaag taaacctcag
      721 agccttacta aaaa