Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017136832 1822 bp mRNA linear INV 09-DEC-2024 (LOC108054080), mRNA. ACCESSION XM_017136832 VERSION XM_017136832.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017136832.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1822 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1822 /gene="LOC108054080" /note="uncharacterized LOC108054080; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054080" CDS 139..1656 /gene="LOC108054080" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016992321.2" /db_xref="GeneID:108054080" /translation="MSSGTAGCKRAHSIEVEQPLEAECVEHGLLLVKGRLSPKCSTAR QLKAILDLPERQSREQLTQLSAGGEFKLLFDLEGGEFSYQSEEQVTASSCLLELRSCT AARRIRFRYRRRRSSYRVQPLYLLCRDEEKPAEQQRELLALIDLNLRLVQSIYAHKLQ AAGFPNRTFTLNGECCTFRSQLTREEALAKSEDELWQHFAGEIISCPLWGHQLLLKFV AFIGCTRYDGDAVAASGDSSYANIRRHLKGHAALGGGGLALFGSAHFYAWPRKLAEIG DCVGSSERVDIARLPDESNYRRTYGGVFASTLGAVCHELGHCFDLGHTGDGVMGQGFD YLNRVLTVDQPTEHLPQRIIEASTSSSSSSAVNPPRFTKLKLQGSNSQLLDNYHNQRR HDSFYFARNCAVILAHHRWLNLGLEETASGSFEAAEIQLKRDTKEILSSRPLRLVELR CNRNSLVAHYEEFEEEEVHRFQLPASLWHLLAEQRTHYVFVLTTSGDTKRLSCDS" misc_feature 175..1197 /gene="LOC108054080" /note="Putative peptidase family; Region: Metallopep; pfam12044" /db_xref="CDD:432283" polyA_site 1822 /gene="LOC108054080" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgcctatcg aaagtaccgg taccctgtgc ctctgttggg attttccaat tggatgtttt 61 gaagatctac caattgccat aagtatcgtt cgctaaagaa aaaacgaaga aagccgcgat 121 tctggcgagg atttggcaat gagcagcggc accgccggct gcaagcgtgc gcacagcatc 181 gaggtcgagc agccgctgga ggcggagtgc gtggagcacg gcctgctgct ggtcaaggga 241 cgcctctcgc ccaagtgctc cacggcgcgc cagctgaagg cgattctcga tctcccggag 301 cgccagtcgc gcgagcagct cacccagctc tcagccggcg gcgagttcaa gctgctcttc 361 gatttggagg gaggtgaatt ctcctaccaa agcgaggagc aggttaccgc atcctcctgc 421 ctcctggagc tgcgttcctg cacggccgcc cgcaggattc gcttccgcta ccggcggcgc 481 cgcagctcct accgcgtgca gccgctctac ctgctctgcc gcgacgagga gaagccagcg 541 gagcagcagc gcgagctgct cgccctcatc gatctcaatc tccgcctggt gcagtccatc 601 tatgcgcaca aactccaggc ggcgggcttc ccgaatcgca cttttaccct gaatggcgag 661 tgctgcacct ttcgcagcca gttgacccgg gaggaggctc tcgcgaaaag cgaagacgag 721 ttgtggcagc attttgcggg ggaaatcatc tcctgcccgc tgtggggcca ccagttgctc 781 ctgaagttcg tggccttcat aggttgcacg cgctacgacg gcgacgctgt ggcggccagc 841 ggtgactcct cctacgcgaa catccggcgg catctcaagg gacacgcggc gctcggcggc 901 ggcggattgg cgctctttgg aagcgcccac ttttacgctt ggccgaggaa gctggcggag 961 atcggggatt gtgtggggag cagcgagagg gtggacatcg cccggctgcc ggacgagagc 1021 aactaccgga ggacctacgg cggcgtcttt gccagcacct tgggcgccgt gtgccacgaa 1081 ctgggccact gcttcgattt gggacacacc ggcgatgggg tgatgggcca gggcttcgac 1141 tatttgaatc gcgttctcac cgtggatcag cccacggagc atctgccgca gcggattata 1201 gaggcctcta cctcctcctc ctcctcttca gcggttaatc ctccgcgctt caccaaactg 1261 aaactccagg ggagcaacag ccagctgctg gacaattacc acaaccaaag acgccacgat 1321 agcttctatt tcgcccgcaa ttgcgccgtc atcctggccc accatcgttg gctcaatctt 1381 ggactggagg agaccgccag tggcagcttt gaggccgcag aaatccaact gaaacgggac 1441 accaaagaga tcctttcgag ccgccccctt cggctggtcg agctgcgctg caatcgcaac 1501 agcctggtgg cccactacga ggagttcgag gaggaggaag tgcatcgctt ccagctgccc 1561 gcctccctgt ggcatctgct cgccgagcag cgcacccact acgtcttcgt cctgaccacc 1621 agtggcgaca ccaagcggct gtcctgcgac tcctaggact gcgagcagct cgaggagtca 1681 gatttgcggc cagtcttcgt ttggatcgcc gttgggtcgg aacaaatatt gagtaacgaa 1741 aaaaaaaata tagttaaaat atagcagaca atggcagcca ccgagggatc cgcgcgaatt 1801 cagttcaagg cgctgaaggg at