Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017136832            1822 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054080), mRNA.
ACCESSION   XM_017136832
VERSION     XM_017136832.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017136832.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1822
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1822
                     /gene="LOC108054080"
                     /note="uncharacterized LOC108054080; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054080"
     CDS             139..1656
                     /gene="LOC108054080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016992321.2"
                     /db_xref="GeneID:108054080"
                     /translation="MSSGTAGCKRAHSIEVEQPLEAECVEHGLLLVKGRLSPKCSTAR
                     QLKAILDLPERQSREQLTQLSAGGEFKLLFDLEGGEFSYQSEEQVTASSCLLELRSCT
                     AARRIRFRYRRRRSSYRVQPLYLLCRDEEKPAEQQRELLALIDLNLRLVQSIYAHKLQ
                     AAGFPNRTFTLNGECCTFRSQLTREEALAKSEDELWQHFAGEIISCPLWGHQLLLKFV
                     AFIGCTRYDGDAVAASGDSSYANIRRHLKGHAALGGGGLALFGSAHFYAWPRKLAEIG
                     DCVGSSERVDIARLPDESNYRRTYGGVFASTLGAVCHELGHCFDLGHTGDGVMGQGFD
                     YLNRVLTVDQPTEHLPQRIIEASTSSSSSSAVNPPRFTKLKLQGSNSQLLDNYHNQRR
                     HDSFYFARNCAVILAHHRWLNLGLEETASGSFEAAEIQLKRDTKEILSSRPLRLVELR
                     CNRNSLVAHYEEFEEEEVHRFQLPASLWHLLAEQRTHYVFVLTTSGDTKRLSCDS"
     misc_feature    175..1197
                     /gene="LOC108054080"
                     /note="Putative peptidase family; Region: Metallopep;
                     pfam12044"
                     /db_xref="CDD:432283"
     polyA_site      1822
                     /gene="LOC108054080"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgcctatcg aaagtaccgg taccctgtgc ctctgttggg attttccaat tggatgtttt
       61 gaagatctac caattgccat aagtatcgtt cgctaaagaa aaaacgaaga aagccgcgat
      121 tctggcgagg atttggcaat gagcagcggc accgccggct gcaagcgtgc gcacagcatc
      181 gaggtcgagc agccgctgga ggcggagtgc gtggagcacg gcctgctgct ggtcaaggga
      241 cgcctctcgc ccaagtgctc cacggcgcgc cagctgaagg cgattctcga tctcccggag
      301 cgccagtcgc gcgagcagct cacccagctc tcagccggcg gcgagttcaa gctgctcttc
      361 gatttggagg gaggtgaatt ctcctaccaa agcgaggagc aggttaccgc atcctcctgc
      421 ctcctggagc tgcgttcctg cacggccgcc cgcaggattc gcttccgcta ccggcggcgc
      481 cgcagctcct accgcgtgca gccgctctac ctgctctgcc gcgacgagga gaagccagcg
      541 gagcagcagc gcgagctgct cgccctcatc gatctcaatc tccgcctggt gcagtccatc
      601 tatgcgcaca aactccaggc ggcgggcttc ccgaatcgca cttttaccct gaatggcgag
      661 tgctgcacct ttcgcagcca gttgacccgg gaggaggctc tcgcgaaaag cgaagacgag
      721 ttgtggcagc attttgcggg ggaaatcatc tcctgcccgc tgtggggcca ccagttgctc
      781 ctgaagttcg tggccttcat aggttgcacg cgctacgacg gcgacgctgt ggcggccagc
      841 ggtgactcct cctacgcgaa catccggcgg catctcaagg gacacgcggc gctcggcggc
      901 ggcggattgg cgctctttgg aagcgcccac ttttacgctt ggccgaggaa gctggcggag
      961 atcggggatt gtgtggggag cagcgagagg gtggacatcg cccggctgcc ggacgagagc
     1021 aactaccgga ggacctacgg cggcgtcttt gccagcacct tgggcgccgt gtgccacgaa
     1081 ctgggccact gcttcgattt gggacacacc ggcgatgggg tgatgggcca gggcttcgac
     1141 tatttgaatc gcgttctcac cgtggatcag cccacggagc atctgccgca gcggattata
     1201 gaggcctcta cctcctcctc ctcctcttca gcggttaatc ctccgcgctt caccaaactg
     1261 aaactccagg ggagcaacag ccagctgctg gacaattacc acaaccaaag acgccacgat
     1321 agcttctatt tcgcccgcaa ttgcgccgtc atcctggccc accatcgttg gctcaatctt
     1381 ggactggagg agaccgccag tggcagcttt gaggccgcag aaatccaact gaaacgggac
     1441 accaaagaga tcctttcgag ccgccccctt cggctggtcg agctgcgctg caatcgcaac
     1501 agcctggtgg cccactacga ggagttcgag gaggaggaag tgcatcgctt ccagctgccc
     1561 gcctccctgt ggcatctgct cgccgagcag cgcacccact acgtcttcgt cctgaccacc
     1621 agtggcgaca ccaagcggct gtcctgcgac tcctaggact gcgagcagct cgaggagtca
     1681 gatttgcggc cagtcttcgt ttggatcgcc gttgggtcgg aacaaatatt gagtaacgaa
     1741 aaaaaaaata tagttaaaat atagcagaca atggcagcca ccgagggatc cgcgcgaatt
     1801 cagttcaagg cgctgaaggg at