Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017136829 404 bp mRNA linear INV 09-DEC-2024 (LOC108054078), mRNA. ACCESSION XM_017136829 VERSION XM_017136829.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017136829.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..404 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..404 /gene="LOC108054078" /note="uncharacterized LOC108054078; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054078" CDS 111..404 /gene="LOC108054078" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016992318.2" /db_xref="GeneID:108054078" /translation="MDLDLSRDDMMKELKKREIYLPDEESLSLDRLEEIYRKFVIPRP RREREPRHPNPIPMEMEQLTQRIKSVAMVGQKRPLPAAPSDDDRPKQIKMDLR" ORIGIN 1 gatggggaca taatctttag actcccatcg ctttatatgt agataagaaa ccgacctttg 61 tttatatttt gatcatagta tttaaataaa aatacagaat atattggaaa atggacttgg 121 atctgtcccg agatgatatg atgaaggagc tcaaaaagag ggagatatat ttgcccgatg 181 aggagagtct ttcgctggat cggctggagg aaatataccg gaaatttgtg atcccccggc 241 caaggagaga gcgggaacca cgccatccca atccaattcc catggaaatg gaacagttga 301 cgcagcgcat caaatcggtg gccatggtgg ggcaaaagcg accactgccg gcggctccga 361 gcgacgacga tagacccaag caaatcaaga tggacctgcg ctga