Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106096067


LOCUS       XM_013263612             808 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096067), transcript variant X1, mRNA.
ACCESSION   XM_013263612
VERSION     XM_013263612.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263612.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..808
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..808
                     /gene="LOC106096067"
                     /note="uncharacterized LOC106096067; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106096067"
     CDS             209..700
                     /gene="LOC106096067"
                     /codon_start=1
                     /product="uncharacterized protein LOC106096067"
                     /protein_id="XP_013119066.1"
                     /db_xref="GeneID:106096067"
                     /translation="MSHSVTITRTTTNTSYIVLNTGYLKSFSGLLKLCQLLLGAAMVG
                     IFSYYQQNGYCFPGYDGIVFAFLMSVTFMIGTFCLLLSCLTSLSTGAIISKTIYELIY
                     HFVAAILLLACSLQVIIILSDRGHRGNKQLDAYFAAGIIGLINAALYFISTLLAHRSY
                     RGI"
     polyA_site      808
                     /gene="LOC106096067"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgatttcctc cgcagccaat cagtcagtct gaaatcaaac atacgcgtgt gaagacgtgc
       61 taaaagcatt gcaaagctcg aaccaaccgt tagcattcga caaaattgag aaaccagtta
      121 aaaaaaaaaa aaacaattaa aaaccaccca cctataccca gctacttttc ttccaaatat
      181 cacttctagt ccttaaacag ccaacaaaat gtctcactcc gtgactatta ctcgtaccac
      241 caccaatact tcctacattg ttttaaatac tggctatttg aaaagtttca gtggtctttt
      301 gaaactctgt caactgcttc ttggcgctgc catggttggc attttcagtt actaccaaca
      361 aaatggatac tgctttcccg gttatgacgg catcgttttc gcttttctaa tgtcagtgac
      421 atttatgata ggaacgttct gcctactgtt gtcatgtttg acgtcgctta gtacgggagc
      481 aattatatca aaaacaattt atgaattaat ttatcacttt gtagctgcta ttctattatt
      541 ggcctgctct ttgcaagtta tcattatatt gagtgataga ggacatagag gtaacaaaca
      601 actggatgct tatttcgcgg ctggcatcat tggtttgatc aatgctgcat tatactttat
      661 cagtacactc ttagcccacc gatcttatcg tggtatttaa atatacacca taaaaccaaa
      721 agaaaaacag atttcataca aattcgagta tagtatccaa agtaaaataa agtttacgat
      781 tacaataaaa aggaatttac ttacgaaa