PREDICTED: Stomoxys calcitrans acyl-CoA-binding domain-containing

LOCUS       XM_013263611             605 bp    mRNA    linear   INV 02-SEP-2023
            protein 7 (LOC106096066), transcript variant X2, mRNA.
ACCESSION   XM_013263611
VERSION     XM_013263611.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263611.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..605
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..605
                     /gene="LOC106096066"
                     /note="acyl-CoA-binding domain-containing protein 7;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 16 Proteins"
                     /db_xref="GeneID:106096066"
     CDS             135..407
                     /gene="LOC106096066"
                     /codon_start=1
                     /product="acyl-CoA-binding domain-containing protein 7"
                     /protein_id="XP_013119065.1"
                     /db_xref="GeneID:106096066"
                     /translation="MATQEEFDKAAEDVKNLKSTPSDNDLLELYGLYKQATVGDCNTA
                     KPGFLDFKGKAKWEAWNGRKGMSNSDALNAYVQKVKSLIETVGLKA"
     misc_feature    144..395
                     /gene="LOC106096066"
                     /note="Acyl CoA binding protein (ACBP) binds thiol esters
                     of long fatty acids and coenzyme A in a one-to-one binding
                     mode with high specificity and affinity. Acyl-CoAs are
                     important intermediates in fatty lipid synthesis and fatty
                     acid degradation and play a...; Region: ACBP; cd00435"
                     /db_xref="CDD:238248"
     misc_feature    order(165..167,174..179,183..185,192..197,201..203,
                     210..215,219..224,231..236,285..290,297..302,357..359)
                     /gene="LOC106096066"
                     /note="acyl-CoA binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238248"
     misc_feature    order(177..179,222..224,231..236,300..302,357..359)
                     /gene="LOC106096066"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:238248"
     polyA_site      605
                     /gene="LOC106096066"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtattttgt taaactagtt cataattccg ttattagatc ttaaatcttt gtttaaaaca
       61 tgatataaga cagggagggg ctaataacgt attttattag caacgcacaa gtacacatct
      121 atcacaaaga aaaaatggca acacaagagg aattcgacaa agccgctgaa gatgtcaaga
      181 atttgaaatc tactccatct gataacgacc tactggaact gtatggtctt tataaacaag
      241 caacagtcgg cgactgtaac acagctaagc ccggcttttt ggatttcaaa ggcaaagcaa
      301 aatgggaagc atggaatggc cgcaagggca tgagcaatag cgatgccctt aatgcatacg
      361 tgcaaaaagt caaatccctc attgaaaccg tcggtttaaa agcttaaatg gattggaatt
      421 gaattggaaa ctattacaaa atgtgtgcaa tctatataca tagcgcttta ttaaatatta
      481 atttaaatag aatactgaca tttatagtga atgaaacaga gaatgtaaag cacaattttt
      541 acattttact tctaaagtaa taataataaa gcacattctt ttgaatgtca tgcacaatga
      601 cgaaa