PREDICTED: Stomoxys calcitrans acyl-CoA-binding domain-containing

LOCUS       XM_013263610             619 bp    mRNA    linear   INV 02-SEP-2023
            protein 7 (LOC106096066), transcript variant X1, mRNA.
ACCESSION   XM_013263610
VERSION     XM_013263610.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263610.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..619
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..619
                     /gene="LOC106096066"
                     /note="acyl-CoA-binding domain-containing protein 7;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 16 Proteins"
                     /db_xref="GeneID:106096066"
     CDS             149..421
                     /gene="LOC106096066"
                     /codon_start=1
                     /product="acyl-CoA-binding domain-containing protein 7"
                     /protein_id="XP_013119064.1"
                     /db_xref="GeneID:106096066"
                     /translation="MATQEEFDKAAEDVKNLKSTPSDNDLLELYGLYKQATVGDCNTA
                     KPGFLDFKGKAKWEAWNGRKGMSNSDALNAYVQKVKSLIETVGLKA"
     misc_feature    158..409
                     /gene="LOC106096066"
                     /note="Acyl CoA binding protein (ACBP) binds thiol esters
                     of long fatty acids and coenzyme A in a one-to-one binding
                     mode with high specificity and affinity. Acyl-CoAs are
                     important intermediates in fatty lipid synthesis and fatty
                     acid degradation and play a...; Region: ACBP; cd00435"
                     /db_xref="CDD:238248"
     misc_feature    order(179..181,188..193,197..199,206..211,215..217,
                     224..229,233..238,245..250,299..304,311..316,371..373)
                     /gene="LOC106096066"
                     /note="acyl-CoA binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238248"
     misc_feature    order(191..193,236..238,245..250,314..316,371..373)
                     /gene="LOC106096066"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:238248"
     polyA_site      619
                     /gene="LOC106096066"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatttcact ttaacgcaga aacttactaa attccatcga ctttgtcaac cacccggcac
       61 catttattat caccacgaat catacatcgc acgatattaa gggtatttta ttagcaacgc
      121 acaagtacac atctatcaca aagaaaaaat ggcaacacaa gaggaattcg acaaagccgc
      181 tgaagatgtc aagaatttga aatctactcc atctgataac gacctactgg aactgtatgg
      241 tctttataaa caagcaacag tcggcgactg taacacagct aagcccggct ttttggattt
      301 caaaggcaaa gcaaaatggg aagcatggaa tggccgcaag ggcatgagca atagcgatgc
      361 ccttaatgca tacgtgcaaa aagtcaaatc cctcattgaa accgtcggtt taaaagctta
      421 aatggattgg aattgaattg gaaactatta caaaatgtgt gcaatctata tacatagcgc
      481 tttattaaat attaatttaa atagaatact gacatttata gtgaatgaaa cagagaatgt
      541 aaagcacaat ttttacattt tacttctaaa gtaataataa taaagcacat tcttttgaat
      601 gtcatgcaca atgacgaaa