Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans E3 ubiquitin-protein ligase RNF185


LOCUS       XM_013263599            1130 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096060), transcript variant X1, mRNA.
ACCESSION   XM_013263599
VERSION     XM_013263599.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263599.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1130
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1130
                     /gene="LOC106096060"
                     /note="E3 ubiquitin-protein ligase RNF185; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 18 Proteins"
                     /db_xref="GeneID:106096060"
     CDS             236..1039
                     /gene="LOC106096060"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase RNF185"
                     /protein_id="XP_013119053.2"
                     /db_xref="GeneID:106096060"
                     /translation="MSTDSPIPTAPELPTTSHNNTAEGDAWNTAFSDNHTTNTYTTNT
                     TATITSCDSTDSPNIKEKMATASTPTPSSTAYSFPGSALNSENFKDNTNNDKTAGGDK
                     KEEEKVEESMFECNICLDTAKDAVVSMCGHLFCWPCLHQWLETRPNRKLCPVCKAAIG
                     KDKVIPLYGRNSTKQEDPRNKVPPRPAGQRTEPEPQQGLPGFSFADGFHMSFGIGAFP
                     FGYFASSLNFGEARPAPANRGTTQYEDEQQLSKLFLYLAFLCIAWLLFA"
     polyA_site      1130
                     /gene="LOC106096060"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgatcacaa gattgtatat ttatttattt agacacccgc aagcaacaag aaacttttga
       61 aaaagaaaca catcgattag aaaattgatc aaaaggatta ttcatataca tcaaacacat
      121 tattgcttgg agaaaaatag tccattggaa aattttcaat tagcagttat tgtgacttaa
      181 gtagtgaaaa atatcacaat tttgagtttc acaaacctac atagatacgt aaaaaatgtc
      241 aacggattca ccaataccaa cagcaccgga actacccaca acatcacaca ataatacggc
      301 agaaggagat gcatggaata cagcatttag tgataatcac acaactaata cttataccac
      361 taacacaacc gccactataa catcttgtga ttcgactgat tctcccaata taaaagaaaa
      421 gatggcgacg gcatcaacac caacgccatc atcgactgct tattcatttc ctggtagtgc
      481 attgaatagt gaaaacttca aagataatac taacaatgat aagaccgctg gcggcgataa
      541 aaaagaagag gaaaaagttg aagaatccat gtttgaatgc aacatatgtt tggatacagc
      601 caaggatgct gtggtcagta tgtgtggtca tctattctgt tggccctgct tgcatcaatg
      661 gctagagacg agaccaaatc gtaaattatg tccagtgtgt aaagctgcca ttggcaaaga
      721 taaagtaata cctttatatg gtcgcaacag taccaagcag gaagatccaa gaaataaagt
      781 tccaccacgt cctgctggcc aacgtactga acctgagccc cagcaagggc ttccaggatt
      841 tagtttcgct gacggttttc acatgtcctt tggaatcggt gcttttccat ttggttattt
      901 tgcatcatct ttaaattttg gcgaagcacg cccagcacct gccaatcgtg gtacaactca
      961 gtatgaagat gagcaacagc tttcgaaact ttttttatat ttggcgtttc tgtgcattgc
     1021 ctggcttttg tttgcatagc cagatgttaa taagctgtat tattattgaa tattgaacat
     1081 acatacaaat atgaaaaacg aaactgctct aaaatgatga tcatagtaaa