Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans armadillo segment polarity protein


LOCUS       XM_013263583            2877 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096056), transcript variant X3, mRNA.
ACCESSION   XM_013263583
VERSION     XM_013263583.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263583.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2877
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..2877
                     /gene="LOC106096056"
                     /note="armadillo segment polarity protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 11 Proteins"
                     /db_xref="GeneID:106096056"
     CDS             156..2624
                     /gene="LOC106096056"
                     /codon_start=1
                     /product="armadillo segment polarity protein isoform X2"
                     /protein_id="XP_013119037.1"
                     /db_xref="GeneID:106096056"
                     /translation="MSFMQTQNRTMSHNNQYNPPELPPMVSSKEQTLMWQQNSYLVDS
                     GIHSGAVTQAPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLAEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLSNPSPRLVQNCLWT
                     LRNLSDAATKVDGLEGLLQSLVQVLASTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTTRHADSEMAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWGNADLGLGPDLQDMLGPEQAYEGLYGQGPPSVHSSHG
                     GRAFQQGYDTLPIDSMQGLEISSPVGGGGGGGAPPSAAPTSPYSMDMDVGEIDAGALN
                     FDLDAMPTPPNDNNNLAAWYDTDC"
     misc_feature    408..632
                     /gene="LOC106096056"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(426..437,447..452,456..464,471..476,483..485,
                     537..545,549..554,561..566,573..575,582..608)
                     /gene="LOC106096056"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <603..>1097
                     /gene="LOC106096056"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    636..713
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    732..848
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    867..965
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(936..938,948..950,960..962,1062..1064,1074..1076,
                     1086..1088,1191..1193,1203..1205,1215..1217)
                     /gene="LOC106096056"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    987..1097
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1113..1220
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1236..1349
                     /gene="LOC106096056"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1239..1346
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1383..1460
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1431..1433,1443..1445,1455..1457,1563..1565,
                     1575..1577,1587..1589,1701..1703,1713..1715,1725..1727)
                     /gene="LOC106096056"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1470..1598
                     /gene="LOC106096056"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1482..1598
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1623..1730
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1905..1907,1917..1919,1929..1931,2028..2030,
                     2040..2042,2052..2054,2151..2153,2163..2165,2175..2177)
                     /gene="LOC106096056"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1944..2063
                     /gene="LOC106096056"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1953..2063
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2076..2180
                     /gene="LOC106096056"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     polyA_site      2877
                     /gene="LOC106096056"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcattcgtt tttgtgttcg tccgtcgctt atcaattgtc tgtgaaaatt tattaatttt
       61 tcgacgtaaa aagtgattag aaataaaata aagtatatat aattgtcatt ttaaacattc
      121 tgtgcggtgt ggtgtacaac gcctaaatca ccaaaatgag tttcatgcaa acacaaaatc
      181 gtacaatgtc tcacaacaat cagtacaatc cgccggagtt gcctccaatg gtttcgtcaa
      241 aggaacaaac cttgatgtgg caacaaaatt cttatctagt ggattctggt atccattcgg
      301 gagctgtaac ccaagccccc tcattgtccg gcaaagaaga tgaagaaatg gagggtgatc
      361 cattgatgtt cgatttggac acgggttttc cacagaattt tacccaagat caggtggatg
      421 atatgaatca gcagctaagc cagacacgtt cgcaacgtgt acgtgccgcc atgtttcctg
      481 aaacattgga ggagggcata gaaataccat caacacaatt tgatccacaa caaccgaccg
      541 ctgtgcaacg tttggctgaa ccatcgcaaa tgttaaaaca tgctgttgtc aatttaatca
      601 attatcaaga cgatgctgag ttggccactc gtgccatacc agaattgatc aaattgctta
      661 acgatgaaga tcaagtagtt gtctcccaag cagccatgat ggtacaccaa ttgtcgaaga
      721 aagaagcttc ccgtcatgcc attatgaaca gtccccaaat ggtggcagct cttgtgcgtg
      781 ccatttcgaa tagtaacgat ttggaaagta ctaaagctgc cgttggtact cttcataatt
      841 tgtcacatca tcggcaaggt ctcttggcta tattcaagag cggtggtata ccagctttgg
      901 tgaaactgtt atcttctcct gttgagagtg ttctcttcta tgctataacc actttgcata
      961 acttgttatt acatcaagat ggttcaaaaa tggccgtacg tttagctggc ggccttcaga
     1021 agatggtcac tttgttgcaa cgcaataatg tcaaatttct agccattgtc acagattgtc
     1081 tacaaatatt ggcctatggc aatcaagaaa gcaaattaat tatattggct tccggtggtc
     1141 ccaatgaatt ggtgcgcatt atgcgttcct acgattacga gaagttgttg tggaccacat
     1201 cgcgcgtctt gaaagtgttg tctgtttgtt ccagcaataa gccagctatt gtcgatgccg
     1261 gcggtatgca ggcattggcc atgcatttat ccaatccctc gccgcgttta gtccaaaact
     1321 gtctatggac tctgcgaaat ttgtctgatg ccgccaccaa ggttgatggc cttgaggggc
     1381 ttttgcaatc gttggttcaa gttttagctt ctacagatgt caatgtagtc acttgcgccg
     1441 ccggtatact ctcgaatttg acttgcaaca atcaacgcaa taaggctaca gtttgccaag
     1501 taggaggcgt tgatgccctg gtacgtacca ttatcaatgc gggcgatcgt gaagaaatca
     1561 ccgaaccagc tgtctgcgct ttgcgccatt tgaccacacg tcatgccgac tcggaaatgg
     1621 ctcaaaatgc tgttcgtttg aattatggtt tgtcggtgat tgtaaaactt ttgcatccac
     1681 catcccgttg gcctttgatc aaggcagcca ttgggctagt acgtaatctg gctttgtgtc
     1741 cggccaatgc ggcaccgtta agggagcatg gagctataca tcacttggtt cgactcttga
     1801 tgcgtgcttt ccaagacaca gaacgtcaac gttcttctgt tgccacaaca ggctcccaac
     1861 aaccttcggc atacgctgat ggtgtccgta tggaggaaat tgttgaaggc acagttggcg
     1921 ccttgcatat tctggccaga gagtcacata atcgtgcatt gatacgccaa caatcggtaa
     1981 taccgatatt tgttcgttta ctcttcaatg agatagaaaa tatacagcgt gtggctgctg
     2041 gcgttctttg tgaactggca gctgacaaag aaggcgctga aataatcgaa caagaaggtg
     2101 ccactgggcc cttaacagat ttattacact cacgcaacga gggtgttgcc acctatgctg
     2161 cagccgtatt attccgcatg agcgaagaca aaccgcaaga ttacaagaag cgtctatcca
     2221 tagagttaac gaattcgcta ttacgcgaag ataataatat atggggaaat gcagacttag
     2281 gcttgggtcc agatttacag gatatgcttg gcccagagca agcatatgaa ggtctctatg
     2341 gtcagggacc acctagcgtt catagctctc atggcggtcg tgcattccaa caaggatatg
     2401 atactttacc aatagactct atgcagggtc ttgaaatcag cagtcccgta ggaggcggtg
     2461 gcggtggtgg tgccccaccc agcgctgcac caacttcacc atactccatg gatatggatg
     2521 ttggtgaaat tgatgctggc gccttgaatt tcgacttgga tgctatgccc acaccaccca
     2581 atgacaacaa caacttggct gcttggtacg atactgattg ttaagaacaa gaaggaggag
     2641 taggaggagg aaggcaacaa acacagtgga ttatttttaa acaaaaaata agcagttaat
     2701 gaacttatga gaggagtatg gaaaacgaaa attaaaagga tatgcatttt ttgtcttaat
     2761 agtcttataa aggaaaatca aaatgtgtgt gtgctggggg tgtgtacatt gacaggaaaa
     2821 tgtacacatt gttcacccaa aattcaccaa gccactctac actacaccac accacac