Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263580 893 bp mRNA linear INV 02-SEP-2023 (LOC106096055), mRNA. ACCESSION XM_013263580 VERSION XM_013263580.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263580.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..893 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..893 /gene="LOC106096055" /note="uncharacterized LOC106096055; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106096055" CDS 145..636 /gene="LOC106096055" /codon_start=1 /product="uncharacterized protein LOC106096055" /protein_id="XP_013119034.1" /db_xref="GeneID:106096055" /translation="MAFVAVHSRKIVVVALFLAIAGFYIREVSSLDLSHGGIITVTND TRYFVLHPDSSKEVFDKEHYAKGNIMFTSGQRIEGDRLILTYMDQTQYTRNEDVEVLL QYPAEGRKGYYISFVLIYADVSTTDCDAYFVDGGIGQTYCKILIACNKTSNFGYQIYL YGY" misc_feature 364..630 /gene="LOC106096055" /note="Transcription activator MBF2; Region: MBF2; pfam15868" /db_xref="CDD:464913" ORIGIN 1 gctgctccat tgtttgttta taaaaacctt aatatttttt aatgttaact tcaatcgttc 61 tgggatccta tcgaaagaaa catcgataaa taatacaaaa aaaaaaaaaa ctctcgcaca 121 cctatttttt gttgcacaat ttaaatggct ttcgttgcag tgcattcgcg taaaatcgtg 181 gtggtggcgt tgttcttggc catcgctggc ttttacattc gcgaagtgtc ctcgctggac 241 ctatcacacg gcggtattat aacggtgaca aatgatacac gttattttgt cctacatcca 301 gattcttcca aggaagtttt cgacaaggag cactatgcca agggcaatat aatgtttaca 361 tccggtcaac gtattgaagg cgatcgttta attctaacct acatggatca aacacaatac 421 actcgtaacg aggatgtgga agttttgctg caatatcctg cagaaggtcg caaaggatat 481 tacataagtt ttgttctcat ctatgccgat gtatcgacga cagactgtga tgcctatttt 541 gtagatgggg gcattgggca gacctattgc aaaattttga tcgcctgcaa caagacttca 601 aactttggtt atcaaatcta tttgtatggc tattgattca caatatatgc ttgtctatgt 661 aaagagaaat ggagaaatag taacaaaaca aagatctgtg attcaattgt aactaaatgt 721 gtctcattac aacaaaagca acatgtctgc agggatgtgt taagtttaat ttagtttctg 781 tttgttaact taattttata cataagcttt attagttttt taagttctat ttgtaaagaa 841 tgttgaaaga aaaaaatata tatttaaaaa ccaaaaaaaa aaaaacaaca cag