Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106096055


LOCUS       XM_013263580             893 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096055), mRNA.
ACCESSION   XM_013263580
VERSION     XM_013263580.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263580.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..893
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..893
                     /gene="LOC106096055"
                     /note="uncharacterized LOC106096055; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106096055"
     CDS             145..636
                     /gene="LOC106096055"
                     /codon_start=1
                     /product="uncharacterized protein LOC106096055"
                     /protein_id="XP_013119034.1"
                     /db_xref="GeneID:106096055"
                     /translation="MAFVAVHSRKIVVVALFLAIAGFYIREVSSLDLSHGGIITVTND
                     TRYFVLHPDSSKEVFDKEHYAKGNIMFTSGQRIEGDRLILTYMDQTQYTRNEDVEVLL
                     QYPAEGRKGYYISFVLIYADVSTTDCDAYFVDGGIGQTYCKILIACNKTSNFGYQIYL
                     YGY"
     misc_feature    364..630
                     /gene="LOC106096055"
                     /note="Transcription activator MBF2; Region: MBF2;
                     pfam15868"
                     /db_xref="CDD:464913"
ORIGIN      
        1 gctgctccat tgtttgttta taaaaacctt aatatttttt aatgttaact tcaatcgttc
       61 tgggatccta tcgaaagaaa catcgataaa taatacaaaa aaaaaaaaaa ctctcgcaca
      121 cctatttttt gttgcacaat ttaaatggct ttcgttgcag tgcattcgcg taaaatcgtg
      181 gtggtggcgt tgttcttggc catcgctggc ttttacattc gcgaagtgtc ctcgctggac
      241 ctatcacacg gcggtattat aacggtgaca aatgatacac gttattttgt cctacatcca
      301 gattcttcca aggaagtttt cgacaaggag cactatgcca agggcaatat aatgtttaca
      361 tccggtcaac gtattgaagg cgatcgttta attctaacct acatggatca aacacaatac
      421 actcgtaacg aggatgtgga agttttgctg caatatcctg cagaaggtcg caaaggatat
      481 tacataagtt ttgttctcat ctatgccgat gtatcgacga cagactgtga tgcctatttt
      541 gtagatgggg gcattgggca gacctattgc aaaattttga tcgcctgcaa caagacttca
      601 aactttggtt atcaaatcta tttgtatggc tattgattca caatatatgc ttgtctatgt
      661 aaagagaaat ggagaaatag taacaaaaca aagatctgtg attcaattgt aactaaatgt
      721 gtctcattac aacaaaagca acatgtctgc agggatgtgt taagtttaat ttagtttctg
      781 tttgttaact taattttata cataagcttt attagttttt taagttctat ttgtaaagaa
      841 tgttgaaaga aaaaaatata tatttaaaaa ccaaaaaaaa aaaaacaaca cag