Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263568 643 bp mRNA linear INV 02-SEP-2023 (LOC106096048), mRNA. ACCESSION XM_013263568 VERSION XM_013263568.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263568.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..643 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..643 /gene="LOC106096048" /note="uncharacterized LOC106096048; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106096048" CDS 56..481 /gene="LOC106096048" /codon_start=1 /product="uncharacterized protein LOC106096048" /protein_id="XP_013119022.1" /db_xref="GeneID:106096048" /translation="MIASTVKYLMVVAAVFALSAKAKPIELKREEITAASVTGRTLFD QYTLGQDVDGARIIYTSQYQQSFDSVQSEITLEYVFPGPDASNDSLITKITLYVEASD DATTQAYVIDGGIGQTSITLQIVAHNSDYLRYMVIVYGK" misc_feature 197..475 /gene="LOC106096048" /note="Transcription activator MBF2; Region: MBF2; pfam15868" /db_xref="CDD:464913" polyA_site 643 /gene="LOC106096048" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttatcgtcat aattttttaa aagtgaattt gtgaactaag tgaaacgcgg atatcatgat 61 tgcgtctaca gttaaatatt tgatggttgt ggcagcagtt tttgccctat ccgccaaggc 121 taaaccaata gaattgaaga gggaagaaat aacagcggcc tctgtaaccg gacgaactct 181 tttcgatcaa tacaccttgg gacaggatgt tgatggtgcc agaatcattt atacttccca 241 ataccaacaa tcatttgaca gtgtccaatc agaaattacc ttggagtatg tatttcccgg 301 cccagatgcc agcaatgatt cgctgatcac caaaattact ttgtatgtgg aggcctctga 361 tgatgccaca acacaagcct atgttatcga tggcggtata ggacagacga gtatcactct 421 gcaaattgta gcccataatt cagattattt gcgttacatg gtgattgttt atggcaaata 481 attgacctaa ttgcgaatat tgataataaa gattaatgcc catattcgca aaagttaatg 541 cagctttaaa gtaggtttat ttgacagttc tttaaaggaa atctctcaaa taaagttgcc 601 ataagttttg tgaatatggg cataaaaatt tgttaaaacg gaa