Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106096048


LOCUS       XM_013263568             643 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096048), mRNA.
ACCESSION   XM_013263568
VERSION     XM_013263568.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263568.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..643
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..643
                     /gene="LOC106096048"
                     /note="uncharacterized LOC106096048; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106096048"
     CDS             56..481
                     /gene="LOC106096048"
                     /codon_start=1
                     /product="uncharacterized protein LOC106096048"
                     /protein_id="XP_013119022.1"
                     /db_xref="GeneID:106096048"
                     /translation="MIASTVKYLMVVAAVFALSAKAKPIELKREEITAASVTGRTLFD
                     QYTLGQDVDGARIIYTSQYQQSFDSVQSEITLEYVFPGPDASNDSLITKITLYVEASD
                     DATTQAYVIDGGIGQTSITLQIVAHNSDYLRYMVIVYGK"
     misc_feature    197..475
                     /gene="LOC106096048"
                     /note="Transcription activator MBF2; Region: MBF2;
                     pfam15868"
                     /db_xref="CDD:464913"
     polyA_site      643
                     /gene="LOC106096048"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttatcgtcat aattttttaa aagtgaattt gtgaactaag tgaaacgcgg atatcatgat
       61 tgcgtctaca gttaaatatt tgatggttgt ggcagcagtt tttgccctat ccgccaaggc
      121 taaaccaata gaattgaaga gggaagaaat aacagcggcc tctgtaaccg gacgaactct
      181 tttcgatcaa tacaccttgg gacaggatgt tgatggtgcc agaatcattt atacttccca
      241 ataccaacaa tcatttgaca gtgtccaatc agaaattacc ttggagtatg tatttcccgg
      301 cccagatgcc agcaatgatt cgctgatcac caaaattact ttgtatgtgg aggcctctga
      361 tgatgccaca acacaagcct atgttatcga tggcggtata ggacagacga gtatcactct
      421 gcaaattgta gcccataatt cagattattt gcgttacatg gtgattgttt atggcaaata
      481 attgacctaa ttgcgaatat tgataataaa gattaatgcc catattcgca aaagttaatg
      541 cagctttaaa gtaggtttat ttgacagttc tttaaaggaa atctctcaaa taaagttgcc
      601 ataagttttg tgaatatggg cataaaaatt tgttaaaacg gaa