PREDICTED: Stomoxys calcitrans RING-box protein 1A (LOC106096045),

LOCUS       XM_013263565             637 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013263565
VERSION     XM_013263565.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263565.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..637
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..637
                     /gene="LOC106096045"
                     /note="RING-box protein 1A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106096045"
     CDS             75..401
                     /gene="LOC106096045"
                     /codon_start=1
                     /product="RING-box protein 1A"
                     /protein_id="XP_013119019.1"
                     /db_xref="GeneID:106096045"
                     /translation="MEVDEEEFEMPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAI
                     CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWD
                     FQKYGH"
     misc_feature    192..377
                     /gene="LOC106096045"
                     /note="modified RING finger, H2 subclass (C3H2C2D-type),
                     found in RING-box protein 1 (RBX1) and similar proteins;
                     Region: mRING-H2-C3H2C2D_RBX1; cd16485"
                     /db_xref="CDD:438148"
     misc_feature    order(288..290,294..296,300..302,315..317,327..329,
                     339..341)
                     /gene="LOC106096045"
                     /note="cullin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:438148"
     polyA_site      637
                     /gene="LOC106096045"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgacttcga ctgttcgact tgcaattttc cttttgaaga gcaacaaaga gtttttttta
       61 ccaaaggcaa cagaatggag gtagatgaag aagagttcga gatgccctca tcgagcagca
      121 agggtgagaa aaaacgcttt gaagtaaaaa agtggaatgc tgttgcttta tgggcctggg
      181 atattgttgt cgacaattgc gccatttgcc gcaaccacat catggactta tgcatcgaat
      241 gtcaagcgaa ccaagcgtct gccaccagcg aggaatgcac tgtagcctgg ggtgtctgta
      301 atcatgcttt tcatttccat tgtatttcgc gctggttaaa aacccgccag gtctgtccat
      361 tggataacag agaatgggat ttccagaaat atggccacta gtgtttaacg atactgtatc
      421 ctcatataca atcactttag ttctactaga gtttgaatat ttaggtttat tttttaattt
      481 tcgttttcta ttccaacata attcatggtt aatacaaaca aaaacactca aatcatatgt
      541 acgtatgtat gtttgtgtaa aaagcttttt gcagaaggaa atgtaatttt gcaaaaaaaa
      601 aaacaagtga acaaaaaggc tgacaaggca aacttaa