Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263564 534 bp mRNA linear INV 02-SEP-2023 (LOC106096044), mRNA. ACCESSION XM_013263564 VERSION XM_013263564.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263564.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..534 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..534 /gene="LOC106096044" /note="uncharacterized LOC106096044; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106096044" CDS 50..469 /gene="LOC106096044" /codon_start=1 /product="uncharacterized protein LOC106096044" /protein_id="XP_013119018.2" /db_xref="GeneID:106096044" /translation="MSRLAALLVVAVLATLIKQPEAQSCLPGPQVFGHSFFGQEVSGA YIPQAYNYMFKDRGNNRRQEINLNYNYTAPEPITEILIFTENQADGSSSASILNGGIG QTWVSMRVTGRNTYFLRYMVVIFCKGSKTPEQVHGIE" polyA_site 534 /gene="LOC106096044" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acttttatag tcttcactct aagtttaaag tttttcaata caagaaacca tgtcccgcct 61 agcagcttta ctggtagttg ctgtacttgc cactttgata aagcaaccag aagcacaaag 121 ttgtttaccc gggccacaag tattcggaca tagttttttt ggacaggaag tttctggtgc 181 ctatataccc caagcctata actacatgtt caaggataga ggaaacaatc gccgtcaaga 241 aataaatctc aattataatt atactgcccc agaacccatt actgaaatcc ttatatttac 301 ggagaatcaa gcagatgggt cgagtagcgc tagcatactc aatggaggta tagggcaaac 361 atgggtgtct atgagagtaa ctggacgaaa tacttatttc ttacgttata tggttgttat 421 attttgtaaa ggcagcaaaa ccccagagca agtacatggt attgaataaa ttttcttagt 481 tcaaaatttt gacagacatg gtaagatggt gattaataaa tctgtggaat ttaa