Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106096044


LOCUS       XM_013263564             534 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096044), mRNA.
ACCESSION   XM_013263564
VERSION     XM_013263564.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263564.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..534
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..534
                     /gene="LOC106096044"
                     /note="uncharacterized LOC106096044; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106096044"
     CDS             50..469
                     /gene="LOC106096044"
                     /codon_start=1
                     /product="uncharacterized protein LOC106096044"
                     /protein_id="XP_013119018.2"
                     /db_xref="GeneID:106096044"
                     /translation="MSRLAALLVVAVLATLIKQPEAQSCLPGPQVFGHSFFGQEVSGA
                     YIPQAYNYMFKDRGNNRRQEINLNYNYTAPEPITEILIFTENQADGSSSASILNGGIG
                     QTWVSMRVTGRNTYFLRYMVVIFCKGSKTPEQVHGIE"
     polyA_site      534
                     /gene="LOC106096044"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acttttatag tcttcactct aagtttaaag tttttcaata caagaaacca tgtcccgcct
       61 agcagcttta ctggtagttg ctgtacttgc cactttgata aagcaaccag aagcacaaag
      121 ttgtttaccc gggccacaag tattcggaca tagttttttt ggacaggaag tttctggtgc
      181 ctatataccc caagcctata actacatgtt caaggataga ggaaacaatc gccgtcaaga
      241 aataaatctc aattataatt atactgcccc agaacccatt actgaaatcc ttatatttac
      301 ggagaatcaa gcagatgggt cgagtagcgc tagcatactc aatggaggta tagggcaaac
      361 atgggtgtct atgagagtaa ctggacgaaa tacttatttc ttacgttata tggttgttat
      421 attttgtaaa ggcagcaaaa ccccagagca agtacatggt attgaataaa ttttcttagt
      481 tcaaaatttt gacagacatg gtaagatggt gattaataaa tctgtggaat ttaa