Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ras-related protein Ral-a


LOCUS       XM_013263507            1420 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096005), mRNA.
ACCESSION   XM_013263507
VERSION     XM_013263507.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263507.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-514               OY720438.1         99486848-99487361   c
            515-902             OY720438.1         99425631-99426018   c
            903-1063            OY720438.1         99423705-99423865   c
            1064-1238           OY720438.1         99391694-99391868   c
            1239-1280           OY720438.1         99384976-99385017   c
            1281-1281           "N"                1-1
            1282-1376           OY720438.1         99384881-99384975   c
            1377-1420           OY720438.1         99375043-99375086   c
FEATURES             Location/Qualifiers
     source          1..1420
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1420
                     /gene="LOC106096005"
                     /note="ras-related protein Ral-a; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     inserted 1 base in 1 codon; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106096005"
     CDS             750..1382
                     /gene="LOC106096005"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: ras-related protein Ral-a"
                     /protein_id="XP_013118961.2"
                     /db_xref="GeneID:106096005"
                     /translation="MSKKPAATPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTK
                     ADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQ
                     EFREQILRVKNDESIPFLLVGNKCDLSDRRRVSLNECQQRAQQWQVPYVETSAKTREN
                     VDKVFYDLIRDISTRKKXTSNRGPGADKNQNSLLPIAVINKQTTTNTPHN"
ORIGIN      
        1 cactcataaa ataacttcca aagtcggtgg tcgcgaggaa aatattttaa caagtttttc
       61 gtaatatagt taaaaatcta acttaaatag gcagaaacaa ctgcatttaa acgcaccttt
      121 aataatctga atgaacgctt ggttgtcggt aaatgtaaca aaaatttact tagttttgct
      181 tgtgtgtacg gaaagtagaa agggcaacac gaaaaaaggc aaagagaaaa cgcgcaaata
      241 attgtgcaaa aaaaaaaaac gaaatccaaa aagagtgtat tgaagaaagc tacaacaaaa
      301 aatatacata gtgacaaatc aaagtgaaaa aaaagcattt accaatatat ttactcaaat
      361 aaaaagcaaa agtgaaatat attgtcaaaa cacaaagtct gcaaaaaagc agtccaccca
      421 tcaaagtagt ctcatcacgc taagtcacag tgacagcagg attttaagga tatttttcat
      481 tccaagaaga taaccaacca tacaactcaa taagtaattc cttgggtatt tttccacacc
      541 catttggtac tgaaactcaa gccgcaccaa cttagagaac tgacgcaatt tttatataca
      601 caacaaactt agaaaatatt gatcctagaa gatttataca aacaaccaga agcagagaga
      661 gagagagaga gagtgaaaga gagaggcagt gacgttacaa agcattacaa aaccaacgac
      721 gacgcataca tcacagcatc tcagtcaaaa tgagtaaaaa gccagcagca acacccgcgt
      781 tacacaaagt gattatggtt ggtagtggtg gtgttggtaa atcagcactc acactacagt
      841 tcatgtacga tgaattcgtt gaggactacg agccaaccaa agcagatagt tataggaaaa
      901 aggttgtttt agatggcgaa gaagtacaaa tagatatatt ggacacagcc ggccaagaag
      961 attatgctgc catccgtgat aattactttc gtagtggtga aggtttcctg tgtgtatttt
     1021 ccataacaga cgacgaaagc ttccaggcta cacaagaatt tagggaacaa attttgcgcg
     1081 ttaaaaatga cgaaagcata ccattcctgt tggttggcaa caaatgcgat ttgagtgaca
     1141 ggcgcagagt ttccctgaac gaatgtcagc agcgagccca gcaatggcag gtgccatatg
     1201 tggaaacatc ggccaagaca cgtgaaaacg tcgataaggt attttacgat cttatcaggg
     1261 atatatcaac acgtaaaaaa ncaacgtcaa accgaggtcc gggagccgac aaaaaccaaa
     1321 actcattgct gccaattgct gtaataaata aacaaacaac aacaaacaca ccacataact
     1381 aaataaggca ggcatatgag tcaatagcaa atcaatttta