Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263507 1420 bp mRNA linear INV 02-SEP-2023 (LOC106096005), mRNA. ACCESSION XM_013263507 VERSION XM_013263507.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; corrected model. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263507.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-514 OY720438.1 99486848-99487361 c 515-902 OY720438.1 99425631-99426018 c 903-1063 OY720438.1 99423705-99423865 c 1064-1238 OY720438.1 99391694-99391868 c 1239-1280 OY720438.1 99384976-99385017 c 1281-1281 "N" 1-1 1282-1376 OY720438.1 99384881-99384975 c 1377-1420 OY720438.1 99375043-99375086 c FEATURES Location/Qualifiers source 1..1420 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1420 /gene="LOC106096005" /note="ras-related protein Ral-a; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106096005" CDS 750..1382 /gene="LOC106096005" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: ras-related protein Ral-a" /protein_id="XP_013118961.2" /db_xref="GeneID:106096005" /translation="MSKKPAATPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTK ADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQ EFREQILRVKNDESIPFLLVGNKCDLSDRRRVSLNECQQRAQQWQVPYVETSAKTREN VDKVFYDLIRDISTRKKXTSNRGPGADKNQNSLLPIAVINKQTTTNTPHN" ORIGIN 1 cactcataaa ataacttcca aagtcggtgg tcgcgaggaa aatattttaa caagtttttc 61 gtaatatagt taaaaatcta acttaaatag gcagaaacaa ctgcatttaa acgcaccttt 121 aataatctga atgaacgctt ggttgtcggt aaatgtaaca aaaatttact tagttttgct 181 tgtgtgtacg gaaagtagaa agggcaacac gaaaaaaggc aaagagaaaa cgcgcaaata 241 attgtgcaaa aaaaaaaaac gaaatccaaa aagagtgtat tgaagaaagc tacaacaaaa 301 aatatacata gtgacaaatc aaagtgaaaa aaaagcattt accaatatat ttactcaaat 361 aaaaagcaaa agtgaaatat attgtcaaaa cacaaagtct gcaaaaaagc agtccaccca 421 tcaaagtagt ctcatcacgc taagtcacag tgacagcagg attttaagga tatttttcat 481 tccaagaaga taaccaacca tacaactcaa taagtaattc cttgggtatt tttccacacc 541 catttggtac tgaaactcaa gccgcaccaa cttagagaac tgacgcaatt tttatataca 601 caacaaactt agaaaatatt gatcctagaa gatttataca aacaaccaga agcagagaga 661 gagagagaga gagtgaaaga gagaggcagt gacgttacaa agcattacaa aaccaacgac 721 gacgcataca tcacagcatc tcagtcaaaa tgagtaaaaa gccagcagca acacccgcgt 781 tacacaaagt gattatggtt ggtagtggtg gtgttggtaa atcagcactc acactacagt 841 tcatgtacga tgaattcgtt gaggactacg agccaaccaa agcagatagt tataggaaaa 901 aggttgtttt agatggcgaa gaagtacaaa tagatatatt ggacacagcc ggccaagaag 961 attatgctgc catccgtgat aattactttc gtagtggtga aggtttcctg tgtgtatttt 1021 ccataacaga cgacgaaagc ttccaggcta cacaagaatt tagggaacaa attttgcgcg 1081 ttaaaaatga cgaaagcata ccattcctgt tggttggcaa caaatgcgat ttgagtgaca 1141 ggcgcagagt ttccctgaac gaatgtcagc agcgagccca gcaatggcag gtgccatatg 1201 tggaaacatc ggccaagaca cgtgaaaacg tcgataaggt attttacgat cttatcaggg 1261 atatatcaac acgtaaaaaa ncaacgtcaa accgaggtcc gggagccgac aaaaaccaaa 1321 actcattgct gccaattgct gtaataaata aacaaacaac aacaaacaca ccacataact 1381 aaataaggca ggcatatgag tcaatagcaa atcaatttta