Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ADP-ribosylation factor-related


LOCUS       XM_013263493             980 bp    mRNA    linear   INV 02-SEP-2023
            protein 1 (LOC106095999), mRNA.
ACCESSION   XM_013263493
VERSION     XM_013263493.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263493.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..980
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..980
                     /gene="LOC106095999"
                     /note="ADP-ribosylation factor-related protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106095999"
     CDS             117..719
                     /gene="LOC106095999"
                     /codon_start=1
                     /product="ADP-ribosylation factor-related protein 1"
                     /protein_id="XP_013118947.1"
                     /db_xref="GeneID:106095999"
                     /translation="MYTLLHGFYKYLTQKDEYCVVILGLDNAGKTTYLEAAKTKFTKN
                     YKGMNPAKITTTVGLNIGTIDVQGVRLNFWDLGGQHELQSLWDKYYQESHAVIYVIDS
                     NDRERMDESKIIFDKMIKNDLLSGVPLLILANKQDLPDVMGVRDIKPVFQQAGGFIGR
                     RDCLTIPVSALTGEGIDEGIKWLVDAIKRHSIVRPPRVND"
     misc_feature    171..674
                     /gene="LOC106095999"
                     /note="Arf-related protein 1 (Arfrp1); Region: Arfrp1;
                     cd04160"
                     /db_xref="CDD:206725"
     misc_feature    186..209
                     /gene="LOC106095999"
                     /note="G1 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(192..212,279..284,348..350,516..521,525..527,
                     621..629)
                     /gene="LOC106095999"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206725"
     misc_feature    order(192..197,207..209,219..221,279..302,366..368,
                     381..383)
                     /gene="LOC106095999"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(222..233,261..293)
                     /gene="LOC106095999"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(282..296,309..311,339..341,351..353,369..371,
                     375..383)
                     /gene="LOC106095999"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206725"
     misc_feature    282..284
                     /gene="LOC106095999"
                     /note="G2 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(285..308,336..338,369..371,378..383)
                     /gene="LOC106095999"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206725"
     misc_feature    order(294..314,321..338)
                     /gene="LOC106095999"
                     /note="interswitch region [active]"
                     /db_xref="CDD:206725"
     misc_feature    339..392
                     /gene="LOC106095999"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206725"
     misc_feature    339..350
                     /gene="LOC106095999"
                     /note="G3 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    516..527
                     /gene="LOC106095999"
                     /note="G4 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    621..629
                     /gene="LOC106095999"
                     /note="G5 box; other site"
                     /db_xref="CDD:206725"
     polyA_site      980
                     /gene="LOC106095999"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcattattct ccggttgtac gtgtaatttt tttgttttta atttgttttc tttaatatcc
       61 aacaaataaa aagttaatgt taattaagtt agaaataacg aaatagtaca actaagatgt
      121 ataccctact gcatggtttc tacaaatact taacacaaaa ggatgaatat tgtgttgtga
      181 ttctcggtct agacaatgcg ggaaaaacga catatttaga ggcagcaaaa actaaattta
      241 caaaaaacta caaaggcatg aatccggcta agattactac cactgtaggt ctcaatattg
      301 gcacaattga tgtacaaggt gttcgtttaa atttttggga cttgggtggc caacatgaat
      361 tgcaatctct ttgggataaa tattatcagg aatcacacgc tgtgatctat gtgattgact
      421 ctaatgaccg agaacgaatg gatgaatcta aaataatatt tgacaaaatg attaaaaacg
      481 atcttttatc tggcgttcca ctactaatct tggctaataa acaagatttg cctgatgtta
      541 tgggcgttag agatattaaa ccagtgtttc aacaagccgg tggctttatt ggtcgaagag
      601 attgtctgac gataccagtg tcggcgctaa caggtgaggg gattgacgaa ggcataaaat
      661 ggttggtgga tgctataaaa cgacactcta tcgtgcgacc acctcgtgta aatgactgat
      721 agagaacata ttgttagaga atacagtgat tttattccag attttatttt taccacataa
      781 agcactttca tttgatttgt aaatatacaa gaaagaaata tttatataaa ttatttataa
      841 catacataat gaatgtataa ggctctcatt tacaagatgt taatgatata tgataaaaat
      901 atatacacgt atatgaaaag agaaatccgt actaaagcaa ttaaaacaaa ctgcttcaag
      961 gtgtggaaac cattcctaaa