Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263493 980 bp mRNA linear INV 02-SEP-2023 protein 1 (LOC106095999), mRNA. ACCESSION XM_013263493 VERSION XM_013263493.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263493.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..980 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..980 /gene="LOC106095999" /note="ADP-ribosylation factor-related protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106095999" CDS 117..719 /gene="LOC106095999" /codon_start=1 /product="ADP-ribosylation factor-related protein 1" /protein_id="XP_013118947.1" /db_xref="GeneID:106095999" /translation="MYTLLHGFYKYLTQKDEYCVVILGLDNAGKTTYLEAAKTKFTKN YKGMNPAKITTTVGLNIGTIDVQGVRLNFWDLGGQHELQSLWDKYYQESHAVIYVIDS NDRERMDESKIIFDKMIKNDLLSGVPLLILANKQDLPDVMGVRDIKPVFQQAGGFIGR RDCLTIPVSALTGEGIDEGIKWLVDAIKRHSIVRPPRVND" misc_feature 171..674 /gene="LOC106095999" /note="Arf-related protein 1 (Arfrp1); Region: Arfrp1; cd04160" /db_xref="CDD:206725" misc_feature 186..209 /gene="LOC106095999" /note="G1 box; other site" /db_xref="CDD:206725" misc_feature order(192..212,279..284,348..350,516..521,525..527, 621..629) /gene="LOC106095999" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206725" misc_feature order(192..197,207..209,219..221,279..302,366..368, 381..383) /gene="LOC106095999" /note="putative GAP interaction site [polypeptide binding]; other site" /db_xref="CDD:206725" misc_feature order(222..233,261..293) /gene="LOC106095999" /note="Switch I region; other site" /db_xref="CDD:206725" misc_feature order(282..296,309..311,339..341,351..353,369..371, 375..383) /gene="LOC106095999" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206725" misc_feature 282..284 /gene="LOC106095999" /note="G2 box; other site" /db_xref="CDD:206725" misc_feature order(285..308,336..338,369..371,378..383) /gene="LOC106095999" /note="putative effector interaction site [active]" /db_xref="CDD:206725" misc_feature order(294..314,321..338) /gene="LOC106095999" /note="interswitch region [active]" /db_xref="CDD:206725" misc_feature 339..392 /gene="LOC106095999" /note="Switch II region; other site" /db_xref="CDD:206725" misc_feature 339..350 /gene="LOC106095999" /note="G3 box; other site" /db_xref="CDD:206725" misc_feature 516..527 /gene="LOC106095999" /note="G4 box; other site" /db_xref="CDD:206725" misc_feature 621..629 /gene="LOC106095999" /note="G5 box; other site" /db_xref="CDD:206725" polyA_site 980 /gene="LOC106095999" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcattattct ccggttgtac gtgtaatttt tttgttttta atttgttttc tttaatatcc 61 aacaaataaa aagttaatgt taattaagtt agaaataacg aaatagtaca actaagatgt 121 ataccctact gcatggtttc tacaaatact taacacaaaa ggatgaatat tgtgttgtga 181 ttctcggtct agacaatgcg ggaaaaacga catatttaga ggcagcaaaa actaaattta 241 caaaaaacta caaaggcatg aatccggcta agattactac cactgtaggt ctcaatattg 301 gcacaattga tgtacaaggt gttcgtttaa atttttggga cttgggtggc caacatgaat 361 tgcaatctct ttgggataaa tattatcagg aatcacacgc tgtgatctat gtgattgact 421 ctaatgaccg agaacgaatg gatgaatcta aaataatatt tgacaaaatg attaaaaacg 481 atcttttatc tggcgttcca ctactaatct tggctaataa acaagatttg cctgatgtta 541 tgggcgttag agatattaaa ccagtgtttc aacaagccgg tggctttatt ggtcgaagag 601 attgtctgac gataccagtg tcggcgctaa caggtgaggg gattgacgaa ggcataaaat 661 ggttggtgga tgctataaaa cgacactcta tcgtgcgacc acctcgtgta aatgactgat 721 agagaacata ttgttagaga atacagtgat tttattccag attttatttt taccacataa 781 agcactttca tttgatttgt aaatatacaa gaaagaaata tttatataaa ttatttataa 841 catacataat gaatgtataa ggctctcatt tacaagatgt taatgatata tgataaaaat 901 atatacacgt atatgaaaag agaaatccgt actaaagcaa ttaaaacaaa ctgcttcaag 961 gtgtggaaac cattcctaaa