Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263481 967 bp mRNA linear INV 02-SEP-2023 (LOC106095993), mRNA. ACCESSION XM_013263481 VERSION XM_013263481.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263481.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..967 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..967 /gene="LOC106095993" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106095993" CDS 123..866 /gene="LOC106095993" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013118935.1" /db_xref="GeneID:106095993" /translation="MERWHRKIAVVTGSSAGIGAATCKALAEKDMIVIGLARRLEKME EQTRPLIEEKYRKNFHTYKCDVGDEANVKEAFAWIEKKFGGIDVLINNAGISPVASLL AADNTKVMKDVVNTNVMGVVWCTREAFQSMKKRSVDGHIINVNSVAGHKVPVVPGYGF HMYAPSKHAMTAMTEVLRQELITQGTKVKVTSVSPGAVRTEIAGTEYPAHIPALDSKD VADAIVFCLQTPPHVQIHELMIRPVGEKF" misc_feature 123..848 /gene="LOC106095993" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(159..161,165..170,174..176,231..239,396..404, 552..560,609..611,621..623,705..716) /gene="LOC106095993" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(471..473,558..560,609..611,621..623) /gene="LOC106095993" /note="active site" /db_xref="CDD:187535" ORIGIN 1 ttcatatgcc aaaataagcg caaattcatt taaaaataaa acatggaaca aaataaattt 61 tatgttcagt cataaagtag agttgtgaaa gcaaatacgt tctcctgccg aaagaaaaaa 121 ccatggaacg ttggcataga aaaatcgccg ttgttaccgg atccagtgct ggcattgggg 181 ctgccacctg caaagctcta gccgagaagg atatgatagt gataggtttg gctagacgcc 241 tggagaaaat ggaagaacaa acaaggcccc tgatagagga aaaatatcgc aagaatttcc 301 atacctacaa atgtgatgtg ggcgatgagg cgaatgtcaa ggaagccttt gcctggattg 361 aaaagaaatt cggtggcatt gatgttctaa tcaacaatgc tggcatatct cccgtagcct 421 ctttgttagc agccgataat acaaaagtga tgaaagatgt ggtaaacacc aatgttatgg 481 gtgtagtgtg gtgtacacga gaggccttcc aaagtatgaa aaagcgaagt gttgatggtc 541 acatcatcaa tgtgaacagt gttgccggcc ataaggttcc agttgtccca ggctatggtt 601 ttcatatgta tgcaccctca aaacatgcta tgacagcgat gacagaggtc ttgaggcaag 661 agctgataac tcagggaacc aaagtcaaag tgacgagtgt cagcccaggt gcagttcgta 721 ccgaaattgc tggtactgaa tatccagccc acataccagc tctagatagc aaagatgtgg 781 ccgatgctat tgtcttttgc ctacaaactc caccacatgt tcaaattcat gaacttatga 841 tacgaccagt aggggaaaaa ttctaaaatc ctgaaaatat tacttgaatg cctactcaat 901 gtatgacgtg tttctaatta caaaaaaaat ctaataattt attttatatt aaaatgttta 961 gaaattt