Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013263481             967 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095993), mRNA.
ACCESSION   XM_013263481
VERSION     XM_013263481.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263481.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..967
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..967
                     /gene="LOC106095993"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106095993"
     CDS             123..866
                     /gene="LOC106095993"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013118935.1"
                     /db_xref="GeneID:106095993"
                     /translation="MERWHRKIAVVTGSSAGIGAATCKALAEKDMIVIGLARRLEKME
                     EQTRPLIEEKYRKNFHTYKCDVGDEANVKEAFAWIEKKFGGIDVLINNAGISPVASLL
                     AADNTKVMKDVVNTNVMGVVWCTREAFQSMKKRSVDGHIINVNSVAGHKVPVVPGYGF
                     HMYAPSKHAMTAMTEVLRQELITQGTKVKVTSVSPGAVRTEIAGTEYPAHIPALDSKD
                     VADAIVFCLQTPPHVQIHELMIRPVGEKF"
     misc_feature    123..848
                     /gene="LOC106095993"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(159..161,165..170,174..176,231..239,396..404,
                     552..560,609..611,621..623,705..716)
                     /gene="LOC106095993"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(471..473,558..560,609..611,621..623)
                     /gene="LOC106095993"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
        1 ttcatatgcc aaaataagcg caaattcatt taaaaataaa acatggaaca aaataaattt
       61 tatgttcagt cataaagtag agttgtgaaa gcaaatacgt tctcctgccg aaagaaaaaa
      121 ccatggaacg ttggcataga aaaatcgccg ttgttaccgg atccagtgct ggcattgggg
      181 ctgccacctg caaagctcta gccgagaagg atatgatagt gataggtttg gctagacgcc
      241 tggagaaaat ggaagaacaa acaaggcccc tgatagagga aaaatatcgc aagaatttcc
      301 atacctacaa atgtgatgtg ggcgatgagg cgaatgtcaa ggaagccttt gcctggattg
      361 aaaagaaatt cggtggcatt gatgttctaa tcaacaatgc tggcatatct cccgtagcct
      421 ctttgttagc agccgataat acaaaagtga tgaaagatgt ggtaaacacc aatgttatgg
      481 gtgtagtgtg gtgtacacga gaggccttcc aaagtatgaa aaagcgaagt gttgatggtc
      541 acatcatcaa tgtgaacagt gttgccggcc ataaggttcc agttgtccca ggctatggtt
      601 ttcatatgta tgcaccctca aaacatgcta tgacagcgat gacagaggtc ttgaggcaag
      661 agctgataac tcagggaacc aaagtcaaag tgacgagtgt cagcccaggt gcagttcgta
      721 ccgaaattgc tggtactgaa tatccagccc acataccagc tctagatagc aaagatgtgg
      781 ccgatgctat tgtcttttgc ctacaaactc caccacatgt tcaaattcat gaacttatga
      841 tacgaccagt aggggaaaaa ttctaaaatc ctgaaaatat tacttgaatg cctactcaat
      901 gtatgacgtg tttctaatta caaaaaaaat ctaataattt attttatatt aaaatgttta
      961 gaaattt