Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013263480             860 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095992), mRNA.
ACCESSION   XM_013263480
VERSION     XM_013263480.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263480.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..860
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..860
                     /gene="LOC106095992"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106095992"
     CDS             55..804
                     /gene="LOC106095992"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013118934.1"
                     /db_xref="GeneID:106095992"
                     /translation="MERWQNKIAVVTGASAGIGAAICKALVEQGMIVVGLARRLEKIE
                     TQTRSLIGEKYQKNFHSYKCDVGVEESVKEAFAWIAMKFGGVDILINNAGVFKPIKLI
                     DEDNSQSISETINTNIMGVIWCTREAFRNMKQRNVDGHIIIINSVAGHRIPIIPLYSL
                     NAYAPSKHAVTAMTEVLRQEFQTEQTKIKITSISPGGVRTEIIGNLPKEYANIPLLDS
                     KDIADAVVFCIQTPPHVQIHEMIIKPIGEKS"
     misc_feature    55..786
                     /gene="LOC106095992"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(91..93,97..102,106..108,163..171,328..336,484..492,
                     541..543,553..555,637..648)
                     /gene="LOC106095992"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(403..405,490..492,541..543,553..555)
                     /gene="LOC106095992"
                     /note="active site"
                     /db_xref="CDD:187535"
     polyA_site      860
                     /gene="LOC106095992"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtagcccta acagcaacac gcaacaatcg gaagcgacat cgaaatcact ggacatggaa
       61 cgttggcaaa acaaaatcgc cgtggtcact ggcgcaagtg ccggcatagg tgctgccata
      121 tgtaaagccc ttgtcgagca gggaatgata gtggtgggct tggcaagacg tctggaaaaa
      181 atagaaaccc aaacgcgttc tttgataggt gaaaaatatc aaaagaattt ccacagctat
      241 aaatgcgatg ttggtgtgga ggagagtgta aaggaagctt ttgcttggat tgccatgaaa
      301 tttggtggtg tcgatattct cattaacaat gctggcgttt tcaaaccaat taaactcatt
      361 gatgaggata attcgcaaag cattagtgaa actattaata caaatataat gggtgtgatt
      421 tggtgtacac gtgaggcttt ccgcaacatg aaacagcgta atgtcgatgg tcatattata
      481 attatcaaca gtgttgctgg acacagaatt ccaattatac ctctgtacag tttaaatgcc
      541 tatgcaccct ccaagcatgc agtgacggca atgaccgaag ttttgagaca agaatttcaa
      601 acggaacaaa ctaaaattaa aattacgagc atcagtcctg gcggcgttcg aactgaaatt
      661 attggcaatc ttcctaaaga gtatgctaat ataccgttgt tggatagtaa agatattgcc
      721 gatgcagttg tattttgtat tcaaacacct cctcatgtcc aaattcatga aatgattatt
      781 aaaccaattg gagaaaaatc ttaaaaattt caaatatata tagaagccat attaacaaaa
      841 gaaataaata taaaatttca