Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263480 860 bp mRNA linear INV 02-SEP-2023 (LOC106095992), mRNA. ACCESSION XM_013263480 VERSION XM_013263480.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263480.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..860 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..860 /gene="LOC106095992" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106095992" CDS 55..804 /gene="LOC106095992" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013118934.1" /db_xref="GeneID:106095992" /translation="MERWQNKIAVVTGASAGIGAAICKALVEQGMIVVGLARRLEKIE TQTRSLIGEKYQKNFHSYKCDVGVEESVKEAFAWIAMKFGGVDILINNAGVFKPIKLI DEDNSQSISETINTNIMGVIWCTREAFRNMKQRNVDGHIIIINSVAGHRIPIIPLYSL NAYAPSKHAVTAMTEVLRQEFQTEQTKIKITSISPGGVRTEIIGNLPKEYANIPLLDS KDIADAVVFCIQTPPHVQIHEMIIKPIGEKS" misc_feature 55..786 /gene="LOC106095992" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(91..93,97..102,106..108,163..171,328..336,484..492, 541..543,553..555,637..648) /gene="LOC106095992" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(403..405,490..492,541..543,553..555) /gene="LOC106095992" /note="active site" /db_xref="CDD:187535" polyA_site 860 /gene="LOC106095992" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtagcccta acagcaacac gcaacaatcg gaagcgacat cgaaatcact ggacatggaa 61 cgttggcaaa acaaaatcgc cgtggtcact ggcgcaagtg ccggcatagg tgctgccata 121 tgtaaagccc ttgtcgagca gggaatgata gtggtgggct tggcaagacg tctggaaaaa 181 atagaaaccc aaacgcgttc tttgataggt gaaaaatatc aaaagaattt ccacagctat 241 aaatgcgatg ttggtgtgga ggagagtgta aaggaagctt ttgcttggat tgccatgaaa 301 tttggtggtg tcgatattct cattaacaat gctggcgttt tcaaaccaat taaactcatt 361 gatgaggata attcgcaaag cattagtgaa actattaata caaatataat gggtgtgatt 421 tggtgtacac gtgaggcttt ccgcaacatg aaacagcgta atgtcgatgg tcatattata 481 attatcaaca gtgttgctgg acacagaatt ccaattatac ctctgtacag tttaaatgcc 541 tatgcaccct ccaagcatgc agtgacggca atgaccgaag ttttgagaca agaatttcaa 601 acggaacaaa ctaaaattaa aattacgagc atcagtcctg gcggcgttcg aactgaaatt 661 attggcaatc ttcctaaaga gtatgctaat ataccgttgt tggatagtaa agatattgcc 721 gatgcagttg tattttgtat tcaaacacct cctcatgtcc aaattcatga aatgattatt 781 aaaccaattg gagaaaaatc ttaaaaattt caaatatata tagaagccat attaacaaaa 841 gaaataaata taaaatttca