Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263478 919 bp mRNA linear INV 02-SEP-2023 (LOC106095991), mRNA. ACCESSION XM_013263478 VERSION XM_013263478.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263478.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..919 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..919 /gene="LOC106095991" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106095991" CDS 30..770 /gene="LOC106095991" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013118932.2" /db_xref="GeneID:106095991" /translation="MERWQNKIAVVTGASSGIGAATAKALVAKGMIVVGLDRQLEKME NEIKASIPAELQAKFHCKKCDVSKEECVKETFNWIVNTFGGVDVLINNAGIITKCNLL DENNSEDIRNTFEVNVLAGVWCTREAFHSMKQRNFDGHIVNICSIMGHSIPAGTGFPL NIYPSTKHAVKAMTEVLRQELQNQHTKIKVTNISPGGVKTAIYGPTYPDMPTVSGEDI ADAIVYCIQTPPHVQIHEMIIKPIGEQF" ORIGIN 1 attgccggag attcctaact gaaaacatca tggaacgttg gcaaaataaa atcgcagtag 61 ttactggtgc cagttcgggt attggcgcgg caacagccaa agccttggtc gccaaaggca 121 tgattgtggt gggcctcgac agacaattgg agaaaatgga aaatgaaatt aaagcatcaa 181 ttcctgccga gcttcaagcc aaattccatt gcaaaaagtg tgatgtctcc aaagaggagt 241 gtgtcaaaga gactttcaat tggattgtca atacttttgg tggtgtagat gttttgatca 301 ataatgccgg aattataacg aaatgcaatc tattggatga aaataattct gaagatattc 361 gaaatacttt tgaggttaat gttttggccg gggtatggtg tacccgtgaa gcctttcaca 421 gcatgaaaca gcgtaatttc gatggccata ttgtaaacat ttgcagtatc atgggtcata 481 gcatacccgc gggtacggga tttcccctca acatctatcc atcaacaaaa catgcagtca 541 aagcaatgac ggaggttttg cgacaagagt tgcaaaatca acataccaaa ataaaagtga 601 cgaatatcag tcccggtggt gtaaaaactg ctatatacgg tcctacatac ccggacatgc 661 ctacagtttc aggtgaggac attgccgatg ccatagtcta ttgcatacaa acaccaccac 721 atgtgcaaat tcatgagatg ataataaaac ccattggaga gcagttctga ggaaagataa 781 agaatgttga gatacttcat tgggttggtg ggtataacct tgaccttgtg ggccttatca 841 gcgacaatag aaacattgtt tggaattata atcttttgat aatgtgaaaa aatagttttg 901 gtttgtatgt gggtaacag