Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013263478             919 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095991), mRNA.
ACCESSION   XM_013263478
VERSION     XM_013263478.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263478.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..919
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..919
                     /gene="LOC106095991"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106095991"
     CDS             30..770
                     /gene="LOC106095991"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013118932.2"
                     /db_xref="GeneID:106095991"
                     /translation="MERWQNKIAVVTGASSGIGAATAKALVAKGMIVVGLDRQLEKME
                     NEIKASIPAELQAKFHCKKCDVSKEECVKETFNWIVNTFGGVDVLINNAGIITKCNLL
                     DENNSEDIRNTFEVNVLAGVWCTREAFHSMKQRNFDGHIVNICSIMGHSIPAGTGFPL
                     NIYPSTKHAVKAMTEVLRQELQNQHTKIKVTNISPGGVKTAIYGPTYPDMPTVSGEDI
                     ADAIVYCIQTPPHVQIHEMIIKPIGEQF"
ORIGIN      
        1 attgccggag attcctaact gaaaacatca tggaacgttg gcaaaataaa atcgcagtag
       61 ttactggtgc cagttcgggt attggcgcgg caacagccaa agccttggtc gccaaaggca
      121 tgattgtggt gggcctcgac agacaattgg agaaaatgga aaatgaaatt aaagcatcaa
      181 ttcctgccga gcttcaagcc aaattccatt gcaaaaagtg tgatgtctcc aaagaggagt
      241 gtgtcaaaga gactttcaat tggattgtca atacttttgg tggtgtagat gttttgatca
      301 ataatgccgg aattataacg aaatgcaatc tattggatga aaataattct gaagatattc
      361 gaaatacttt tgaggttaat gttttggccg gggtatggtg tacccgtgaa gcctttcaca
      421 gcatgaaaca gcgtaatttc gatggccata ttgtaaacat ttgcagtatc atgggtcata
      481 gcatacccgc gggtacggga tttcccctca acatctatcc atcaacaaaa catgcagtca
      541 aagcaatgac ggaggttttg cgacaagagt tgcaaaatca acataccaaa ataaaagtga
      601 cgaatatcag tcccggtggt gtaaaaactg ctatatacgg tcctacatac ccggacatgc
      661 ctacagtttc aggtgaggac attgccgatg ccatagtcta ttgcatacaa acaccaccac
      721 atgtgcaaat tcatgagatg ataataaaac ccattggaga gcagttctga ggaaagataa
      781 agaatgttga gatacttcat tgggttggtg ggtataacct tgaccttgtg ggccttatca
      841 gcgacaatag aaacattgtt tggaattata atcttttgat aatgtgaaaa aatagttttg
      901 gtttgtatgt gggtaacag