Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lopap (LOC106095990), mRNA.


LOCUS       XM_013263477             826 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013263477
VERSION     XM_013263477.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263477.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..826
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..826
                     /gene="LOC106095990"
                     /note="lopap; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins"
                     /db_xref="GeneID:106095990"
     CDS             4..726
                     /gene="LOC106095990"
                     /codon_start=1
                     /product="lopap"
                     /protein_id="XP_013118931.2"
                     /db_xref="GeneID:106095990"
                     /translation="MAPSQYRVSICVLLITIICVDHCYSWINFNSVYTSRKRTDLKKR
                     CPDVRALRNFDLEPMMGNWYVVQYYASTEELPEYACMRSHFTFTSDDQHITMNFTYIF
                     AEDPLREKLQGNITWDIPDFNTPAHWMHTEDIYEGIYNTYVLDTDYKSWGLIMHCAEK
                     KKHPRYLSALLLSRETTLGENVINFLKEKLPRYDIDLSFMFPINQTTCDNLMESSQDD
                     PLAYIVNGRKNAKNMFKIILKN"
ORIGIN      
        1 gcaatggcgc cttcgcaata tcgagtatca atttgtgtgt tgcttataac aattatctgt
       61 gtggatcatt gctattcatg gattaatttc aattcagttt atacctcaag gaaacgtaca
      121 gatctaaaaa agagatgtcc agatgtacgt gcactgcgta atttcgattt ggaacccatg
      181 atgggtaatt ggtatgttgt acaatattat gcctccactg aagaactacc cgagtatgca
      241 tgcatgcgaa gtcatttcac cttcaccagt gatgatcagc acattaccat gaactttacc
      301 tacatatttg ccgaggatcc tttacgtgaa aagttgcagg gtaatatcac ttgggacata
      361 cctgatttta atactccagc tcattggatg catactgagg atatatatga aggaatttac
      421 aacacctatg tcctagatac tgattacaaa tcatggggcc tcatcatgca ctgtgccgag
      481 aagaagaaac atcctcgcta tctatcggct ttgttattgt cgcgtgagac cacattgggt
      541 gagaatgtga taaatttcct aaaagaaaag ttgccacgtt atgacattga cttgtccttc
      601 atgttcccca tcaatcaaac cacctgtgat aacctaatgg aatcatcgca agacgatcct
      661 ttggcctaca ttgtaaatgg ccgtaaaaat gccaaaaata tgtttaaaat aattcttaaa
      721 aattaagaaa catacattta gatatataaa acttaaaaaa caaatattgt acttgtagaa
      781 cataatagaa atttttaacc caaaagaaga tcataaacaa gcaaaa