Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263469 507 bp mRNA linear INV 02-SEP-2023 subunit RPC9 (LOC106095984), mRNA. ACCESSION XM_013263469 VERSION XM_013263469.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263469.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..507 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..507 /gene="LOC106095984" /note="DNA-directed RNA polymerase III subunit RPC9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106095984" CDS 82..459 /gene="LOC106095984" /codon_start=1 /product="DNA-directed RNA polymerase III subunit RPC9" /protein_id="XP_013118923.2" /db_xref="GeneID:106095984" /translation="MEVLNPCFSGLCNLEVMEWLRNIKDTKKKYGLRNLATITYETLQ FLEESPCKYETRDSIMHFLKDMETYKLSTKELLMMVNDPPSSALHIQLLIEDSEERLT EDQVNEIIQISKRHFPGPPSDTS" ORIGIN 1 tttctctctt cacatttgct tgcacgttgt ctaatcgttc atatttacaa aatagaagtt 61 gtaaacaact aaaagcagaa aatggaagtt cttaaccctt gtttttctgg tttatgcaat 121 ctggaagtca tggaatggct caggaatatt aaggatacaa aaaagaagta tggtctaaga 181 aacttggcga ctatcaccta cgaaactcta cagtttttgg aggaatctcc atgtaaatat 241 gagacccgtg acagcattat gcatttttta aaagatatgg aaacctataa attgagcaca 301 aaagaattgc tcatgatggt caatgaccca ccttctagtg ctttacacat acagttgtta 361 attgaagaca gtgaggaacg attaaccgag gaccaagtta atgaaattat acaaatatca 421 aagagacact ttcctggtcc tccgagtgat acaagttgat aataaaatct ttgttcgtgt 481 agttaaaaat gttttcgaat ttgtaat