Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DNA-directed RNA polymerase III


LOCUS       XM_013263469             507 bp    mRNA    linear   INV 02-SEP-2023
            subunit RPC9 (LOC106095984), mRNA.
ACCESSION   XM_013263469
VERSION     XM_013263469.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263469.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..507
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..507
                     /gene="LOC106095984"
                     /note="DNA-directed RNA polymerase III subunit RPC9;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 8 Proteins"
                     /db_xref="GeneID:106095984"
     CDS             82..459
                     /gene="LOC106095984"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC9"
                     /protein_id="XP_013118923.2"
                     /db_xref="GeneID:106095984"
                     /translation="MEVLNPCFSGLCNLEVMEWLRNIKDTKKKYGLRNLATITYETLQ
                     FLEESPCKYETRDSIMHFLKDMETYKLSTKELLMMVNDPPSSALHIQLLIEDSEERLT
                     EDQVNEIIQISKRHFPGPPSDTS"
ORIGIN      
        1 tttctctctt cacatttgct tgcacgttgt ctaatcgttc atatttacaa aatagaagtt
       61 gtaaacaact aaaagcagaa aatggaagtt cttaaccctt gtttttctgg tttatgcaat
      121 ctggaagtca tggaatggct caggaatatt aaggatacaa aaaagaagta tggtctaaga
      181 aacttggcga ctatcaccta cgaaactcta cagtttttgg aggaatctcc atgtaaatat
      241 gagacccgtg acagcattat gcatttttta aaagatatgg aaacctataa attgagcaca
      301 aaagaattgc tcatgatggt caatgaccca ccttctagtg ctttacacat acagttgtta
      361 attgaagaca gtgaggaacg attaaccgag gaccaagtta atgaaattat acaaatatca
      421 aagagacact ttcctggtcc tccgagtgat acaagttgat aataaaatct ttgttcgtgt
      481 agttaaaaat gttttcgaat ttgtaat