Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans density-regulated protein homolog


LOCUS       XM_013263468             933 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095983), mRNA.
ACCESSION   XM_013263468
VERSION     XM_013263468.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263468.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..933
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..933
                     /gene="LOC106095983"
                     /note="density-regulated protein homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:106095983"
     CDS             290..844
                     /gene="LOC106095983"
                     /codon_start=1
                     /product="density-regulated protein homolog"
                     /protein_id="XP_013118922.1"
                     /db_xref="GeneID:106095983"
                     /translation="MTEVSPNPVAERLKLGPRDGVTYPIIVNYCGNCSMPIEYCEYYP
                     EYEKCKAWLEKNLPTEFERVKLEEETGDGNDDDKRRQKRGGKGLMKIKKKEEVNKRIT
                     VSRAPRGKKKSVTVVTGLSTFDIDLKVASKFFGSKFACGSSVTGEDEIVIQGDVKDDL
                     FDVIPEKWPDVDADYIEDLGDQKR"
     misc_feature    359..826
                     /gene="LOC106095983"
                     /note="Eukaryotic initiation factor 1 and related
                     proteins; Region: eIF1_SUI1_like; cl00229"
                     /db_xref="CDD:469673"
     misc_feature    order(611..613,620..625,629..631,683..685,692..700,
                     704..712,716..718,746..748,755..757)
                     /gene="LOC106095983"
                     /note="putative rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:211320"
     polyA_site      933
                     /gene="LOC106095983"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaaaatcgt gctatatgaa agaaaatgct tagaaaaatt cttaacctaa ttccgtctat
       61 taaacacatt aatattttgc tctacatgtg tatgcaatat gtctgacatc attccctgaa
      121 gatttttcaa aattcgctct ggcataaata ccggtcacag tagtggcagc actgtattag
      181 caaaaacata tgttttagta aatttggctt ttttggacaa atattttttt tgcagtgaac
      241 attactgcat tgtcgcttag atataaaata tatattagct aattgcagca tgacagaagt
      301 aagcccaaat cctgtagcag aacgtctcaa attaggtcct cgtgatggtg taacttatcc
      361 aataattgtt aactattgcg gcaattgttc aatgcccatt gagtattgtg aatattatcc
      421 tgaatatgag aaatgtaaag catggctaga gaagaatctg cccacagaat ttgaacgtgt
      481 taaattggaa gaagaaactg gcgatggaaa tgatgacgac aaacgtcgtc aaaaacgtgg
      541 cggaaaaggt ctgatgaaaa tcaaaaagaa agaagaggtc aacaagagga tcaccgtgtc
      601 ccgggctccc cgtggcaaaa agaagtctgt aacagttgta acaggattga gcacattcga
      661 cattgacttg aaagtcgctt ccaaattttt cggctcaaaa ttcgcttgtg gctcttcggt
      721 aaccggcgag gacgaaattg tcatccaggg agatgtaaaa gatgacctat tcgatgtgat
      781 accagaaaag tggcccgatg tcgatgcgga ctacatcgag gatttgggcg atcaaaaacg
      841 ctaagttgtg gctggcactt ttgtaagact taagggcatt tttgaataat aaaaattatt
      901 gagtttttat atatgtacgt agaaaaacag caa