Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263468 933 bp mRNA linear INV 02-SEP-2023 (LOC106095983), mRNA. ACCESSION XM_013263468 VERSION XM_013263468.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263468.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..933 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..933 /gene="LOC106095983" /note="density-regulated protein homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:106095983" CDS 290..844 /gene="LOC106095983" /codon_start=1 /product="density-regulated protein homolog" /protein_id="XP_013118922.1" /db_xref="GeneID:106095983" /translation="MTEVSPNPVAERLKLGPRDGVTYPIIVNYCGNCSMPIEYCEYYP EYEKCKAWLEKNLPTEFERVKLEEETGDGNDDDKRRQKRGGKGLMKIKKKEEVNKRIT VSRAPRGKKKSVTVVTGLSTFDIDLKVASKFFGSKFACGSSVTGEDEIVIQGDVKDDL FDVIPEKWPDVDADYIEDLGDQKR" misc_feature 359..826 /gene="LOC106095983" /note="Eukaryotic initiation factor 1 and related proteins; Region: eIF1_SUI1_like; cl00229" /db_xref="CDD:469673" misc_feature order(611..613,620..625,629..631,683..685,692..700, 704..712,716..718,746..748,755..757) /gene="LOC106095983" /note="putative rRNA binding site [nucleotide binding]; other site" /db_xref="CDD:211320" polyA_site 933 /gene="LOC106095983" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaaaatcgt gctatatgaa agaaaatgct tagaaaaatt cttaacctaa ttccgtctat 61 taaacacatt aatattttgc tctacatgtg tatgcaatat gtctgacatc attccctgaa 121 gatttttcaa aattcgctct ggcataaata ccggtcacag tagtggcagc actgtattag 181 caaaaacata tgttttagta aatttggctt ttttggacaa atattttttt tgcagtgaac 241 attactgcat tgtcgcttag atataaaata tatattagct aattgcagca tgacagaagt 301 aagcccaaat cctgtagcag aacgtctcaa attaggtcct cgtgatggtg taacttatcc 361 aataattgtt aactattgcg gcaattgttc aatgcccatt gagtattgtg aatattatcc 421 tgaatatgag aaatgtaaag catggctaga gaagaatctg cccacagaat ttgaacgtgt 481 taaattggaa gaagaaactg gcgatggaaa tgatgacgac aaacgtcgtc aaaaacgtgg 541 cggaaaaggt ctgatgaaaa tcaaaaagaa agaagaggtc aacaagagga tcaccgtgtc 601 ccgggctccc cgtggcaaaa agaagtctgt aacagttgta acaggattga gcacattcga 661 cattgacttg aaagtcgctt ccaaattttt cggctcaaaa ttcgcttgtg gctcttcggt 721 aaccggcgag gacgaaattg tcatccaggg agatgtaaaa gatgacctat tcgatgtgat 781 accagaaaag tggcccgatg tcgatgcgga ctacatcgag gatttgggcg atcaaaaacg 841 ctaagttgtg gctggcactt ttgtaagact taagggcatt tttgaataat aaaaattatt 901 gagtttttat atatgtacgt agaaaaacag caa