PREDICTED: Stomoxys calcitrans protein TsetseEP-like

LOCUS       XM_013263460             658 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095975), mRNA.
ACCESSION   XM_013263460
VERSION     XM_013263460.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263460.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 8% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..658
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..658
                     /gene="LOC106095975"
                     /note="protein TsetseEP-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106095975"
     CDS             38..658
                     /gene="LOC106095975"
                     /codon_start=1
                     /product="protein TsetseEP-like"
                     /protein_id="XP_013118914.2"
                     /db_xref="GeneID:106095975"
                     /translation="MRLLKLLLLIAFVAMAASQGDEENPEETPEETPEETPEETPEET
                     PEETPEETPEETPEETPEETPEEETPEEETPEEETPEEETPEEETPEEETPEEETPEE
                     ETPEEETPEEETPEEEEETPEEEVPEEETGVTTAPGGSTEPGAGAEGTTKATVKKPTK
                     KPTKKKKKKTKFQKQKEKRKRRRNRRKRRKNRNKNKRNKNKNKNRG"
ORIGIN      
        1 actacttcca gtattcagtg gggaaaaaca atccaaaatg aggttgttaa aattattact
       61 tttaattgcc tttgtggcaa tggccgcaag tcaaggagac gaggaaaatc ccgaggaaac
      121 tccagaggaa actccagagg aaacaccaga ggaaactccc gaggaaaccc cagaagaaac
      181 tccagaggaa acgccggagg aaacgccgga ggaaacaccg gaggaaacgc cggaggagga
      241 aacccctgaa gaagaaaccc ctgaggaaga aactcctgag gaagaaaccc ctgaggaaga
      301 aacccctgag gaagaaactc ctgaggagga aacccctgag gaagaaactc ctgaggagga
      361 aacccccgag gaagaaacac ctgaggaaga agaggagact cccgaagagg aggttcccga
      421 agaggaaacc ggtgtcacta ctgctcctgg cggttcaaca gaacctggag ctggtgcaga
      481 gggaacaact aaagctactg taaagaaacc aactaaaaag cccacaaaga agaagaagaa
      541 gaagaccaaa ttccaaaagc aaaaggaaaa gagaaagagg agaaggaaca ggaggaagag
      601 gaggaagaac aggaacaaga acaagagaaa caagaataag aataagaaca ggggctaa