PREDICTED: Stomoxys calcitrans protein twisted gastrulation

LOCUS       XM_013263436             714 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095969), mRNA.
ACCESSION   XM_013263436
VERSION     XM_013263436.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263436.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..714
                     /gene="LOC106095969"
                     /note="protein twisted gastrulation; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106095969"
     CDS             1..714
                     /gene="LOC106095969"
                     /codon_start=1
                     /product="protein twisted gastrulation"
                     /protein_id="XP_013118890.1"
                     /db_xref="GeneID:106095969"
                     /translation="MVNGEGCNEFVCGSVVSKCLLTQSCQCKLSDCYCCKDCLNCLGD
                     LYTECCGCLDMCPKHNDTLSALAPKSQIGDFEGVPEYFEALTAEDDESQWTTVRFPMR
                     NSLQRHYNMATGAFGFGSPHGDLFERESSLAKAIPTTVNCTVIFLNYCTNNKKCADYC
                     ESMGSNSYRWFHDGCCECVGANCFNYGINESRCSACPEDEDDDEMFDVDSMDDAADYA
                     GENEDSIPWDYGEDEMNYN"
     misc_feature    193..591
                     /gene="LOC106095969"
                     /note="Twisted gastrulation (Tsg) protein conserved
                     region; Region: Tsg; pfam04668"
                     /db_xref="CDD:461385"
ORIGIN      
        1 atggtcaacg gtgaaggctg caatgagttc gtttgtggtt ctgtggtctc caagtgcctg
       61 ttgacgcaaa gttgtcagtg caagctatcc gattgctact gttgcaagga ctgtcttaat
      121 tgtttggggg acttgtacac ggagtgctgc ggctgcctgg acatgtgtcc caagcacaat
      181 gatactctaa gtgccctggc gcccaagtca caaattggcg attttgaggg tgttcccgaa
      241 tactttgaag ccctgaccgc agaggacgac gaaagtcaat ggaccactgt tcgcttcccc
      301 atgcgcaaca gtctgcagcg gcactataac atggccacgg gggcatttgg ttttggctcg
      361 ccgcacggag atctatttga gcgtgaaagc tcgttggcta aagcgatacc cacaacggtc
      421 aattgcactg tgatattctt gaattattgc acgaacaata agaaatgtgc ggattactgt
      481 gagagtatgg gttcgaacag ctatcgttgg ttccacgatg gctgctgcga gtgcgttgga
      541 gccaattgct tcaactatgg catcaatgag agccgttgtt ccgcctgtcc agaggatgaa
      601 gatgacgacg aaatgtttga cgttgacagc atggatgatg ctgctgatta tgcgggagag
      661 aatgaggata gcataccatg ggattatggc gaagatgaaa tgaattataa ttaa