Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095968


LOCUS       XM_013263434             627 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095968), mRNA.
ACCESSION   XM_013263434
VERSION     XM_013263434.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263434.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..627
                     /gene="LOC106095968"
                     /note="uncharacterized LOC106095968; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106095968"
     CDS             108..548
                     /gene="LOC106095968"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095968"
                     /protein_id="XP_013118888.2"
                     /db_xref="GeneID:106095968"
                     /translation="MILAVRKHLFASNIFFFFIIFIVQKFIQVFCIIEEKACKNANCP
                     ANKRCDERCVASADDAPPSPNSAAGHSTSSSTYSTPSSTPPPSPKPPVRGLRLIPMAM
                     RKTMRNFGFGEGHFQLFVEEKQRQKYISKSRLNAATAEVKLNPN"
ORIGIN      
        1 acgcactgtg atattttcat ccatcagtgc caacacttcg tacatccatc actaactacg
       61 aaaaactcac tgtttttgga ctgtagaact ctgggatcat cgacaacatg attttggcag
      121 tcaggaaaca tctcttcgct tccaacatct tctttttctt catcattttc atagtgcaga
      181 agttcattca ggtcttctgc atcatcgagg aaaaggcctg caagaatgcc aattgtccgg
      241 cgaacaaacg atgcgatgaa cgttgtgttg cttcagctga tgatgcccca ccgtctccca
      301 actcggctgc aggccattcg acttcctcgt ctacctattc aacaccttcg tcaacgccac
      361 caccatcgcc caaaccccca gtgagaggtc taagactcat acccatggct atgcgtaaga
      421 ctatgcgcaa ttttggtttc ggcgaaggtc attttcaact ctttgtcgag gagaagcaac
      481 gccagaagta catctcaaaa tcccgcttga atgcggccac tgctgaggtt aaactcaatc
      541 ccaattagat ttcaacatgc acaacaactc catgagagag tattttggac aagcatatga
      601 tgtcgatgca atcgatctta ttttcca