Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263434 627 bp mRNA linear INV 02-SEP-2023 (LOC106095968), mRNA. ACCESSION XM_013263434 VERSION XM_013263434.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263434.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..627 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..627 /gene="LOC106095968" /note="uncharacterized LOC106095968; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106095968" CDS 108..548 /gene="LOC106095968" /codon_start=1 /product="uncharacterized protein LOC106095968" /protein_id="XP_013118888.2" /db_xref="GeneID:106095968" /translation="MILAVRKHLFASNIFFFFIIFIVQKFIQVFCIIEEKACKNANCP ANKRCDERCVASADDAPPSPNSAAGHSTSSSTYSTPSSTPPPSPKPPVRGLRLIPMAM RKTMRNFGFGEGHFQLFVEEKQRQKYISKSRLNAATAEVKLNPN" ORIGIN 1 acgcactgtg atattttcat ccatcagtgc caacacttcg tacatccatc actaactacg 61 aaaaactcac tgtttttgga ctgtagaact ctgggatcat cgacaacatg attttggcag 121 tcaggaaaca tctcttcgct tccaacatct tctttttctt catcattttc atagtgcaga 181 agttcattca ggtcttctgc atcatcgagg aaaaggcctg caagaatgcc aattgtccgg 241 cgaacaaacg atgcgatgaa cgttgtgttg cttcagctga tgatgcccca ccgtctccca 301 actcggctgc aggccattcg acttcctcgt ctacctattc aacaccttcg tcaacgccac 361 caccatcgcc caaaccccca gtgagaggtc taagactcat acccatggct atgcgtaaga 421 ctatgcgcaa ttttggtttc ggcgaaggtc attttcaact ctttgtcgag gagaagcaac 481 gccagaagta catctcaaaa tcccgcttga atgcggccac tgctgaggtt aaactcaatc 541 ccaattagat ttcaacatgc acaacaactc catgagagag tattttggac aagcatatga 601 tgtcgatgca atcgatctta ttttcca