PREDICTED: Stomoxys calcitrans uncharacterized LOC106095967

LOCUS       XM_013263433             459 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095967), mRNA.
ACCESSION   XM_013263433
VERSION     XM_013263433.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263433.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..459
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..459
                     /gene="LOC106095967"
                     /note="uncharacterized LOC106095967; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106095967"
     CDS             1..459
                     /gene="LOC106095967"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095967"
                     /protein_id="XP_013118887.2"
                     /db_xref="GeneID:106095967"
                     /translation="MILAARKHLYAINIFFFFVIFIVQKLIKIFCIIEEKACKNANCP
                     TDKRCDERCVAPTATDAVASAASVVSLAAGLTISSASTKVMTSSSAPPSPTSHEGGLS
                     LIPKAMRKTMRNFGFGEGHFQIFVEEKQRYQYMSKPSLNAAFAEVKLNPN"
ORIGIN      
        1 atgattttgg cagccagaaa acatttgtat gccattaaca ttttcttctt tttcgttata
       61 ttcatagtgc aaaagttgat aaaaatcttc tgcatcatcg aggaaaaggc ctgcaaaaat
      121 gccaattgtc cgacggacaa acgatgtgat gaacgttgtg ttgcaccaac tgcaactgat
      181 gctgtggcat ccgcagcctc agttgtttcc ttggcagcag gcctaacaat ttcctccgca
      241 tccacaaaag tgatgacttc atcatcagca ccaccatcgc ccacatccca tgaaggaggt
      301 ctgagtctca tacccaaggc aatgcgcaag actatgcgta attttggttt cggagagggt
      361 cattttcaaa ttttcgttga ggaaaaacaa cgctatcagt atatgtcgaa accctcccta
      421 aatgcagcct ttgccgaggt caaacttaat cccaattag