Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263089 1040 bp mRNA linear INV 02-SEP-2023 protein (LOC106095762), mRNA. ACCESSION XM_013263089 VERSION XM_013263089.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263089.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1040 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1040 /gene="LOC106095762" /note="rhythmically expressed gene 2 protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106095762" CDS 200..961 /gene="LOC106095762" /codon_start=1 /product="rhythmically expressed gene 2 protein" /protein_id="XP_013118543.1" /db_xref="GeneID:106095762" /translation="MASIKCLANLNRFRLVTFDITDTLIRFSRAPAVQYAKTAAQLGV TDIDQVAMERCFKKEFMAMNRQYPNWGCNIPNFTWQQWWSTLVSNIFYCAKPDIDQHK LKELTNILVRTYRTSDCYRHIEGGRELVDRVRNAGKKVGVISNFDPSLKKVLSEVNLA DKFDFILTSYEVGFSKPSKEIYDASLAISKVEAHEALHIGNMYALDYLGARNAGWSSI LITPNEIDLNKAQPTHGFRNIKELLHVLDNDVIEW" misc_feature 239..856 /gene="LOC106095762" /note="REG-2-like, HAD superfamily (subfamily IA) hydrolase; Region: DREG-2; TIGR02252" /db_xref="CDD:274056" polyA_site 1040 /gene="LOC106095762" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttctaactgt caaaatttgc ttgctctcgc gctctcttgc tggcaaataa agtacgcgaa 61 cgacttctaa taaaaatttg tgaaaatttg caaaaatttt tgagttctcg aacacagcta 121 atataaatgt aaacatatgt tttcataata cttctaatta aaaagataga gataaaaata 181 tttttgcaag tttttagtta tggctagtat aaagtgctta gctaacctta accgttttcg 241 cttagtaaca ttcgacataa cagatacatt gatccgcttt agcagagccc cggctgttca 301 gtatgcgaag acggccgcgc aattaggagt taccgatatt gatcaagtag caatggaaag 361 atgctttaaa aaggaattca tggccatgaa tagacagtat cccaactggg gttgcaacat 421 accaaacttc acatggcagc aatggtggtc aaccctggta tccaatattt tctattgtgc 481 caaacctgac attgatcaac acaaactcaa agaactgacg aacattttag ttcgtactta 541 tagaacaagt gattgttatc gtcacatcga aggtggcagg gaactggtcg acagagtacg 601 taatgctggc aagaaagtgg gtgttatttc gaatttcgac ccaagtctga aaaaagtttt 661 atctgaagta aatttagcgg ataagtttga tttcatattg acatcttatg aagtggggtt 721 ttcaaaaccg agcaaggaga tttatgatgc atcgctggca attagtaaag ttgaagccca 781 cgaagcctta catataggaa atatgtatgc cctggattat ttgggtgctc gcaatgctgg 841 ttggtccagc attctaataa caccgaacga aatcgatctt aacaaggctc aaccaacgca 901 tggctttcgt aatattaaag aattattgca cgtcttagac aacgatgtta tagaatggta 961 gtagaataat aacgttttaa atttgcattt tgttaaatta atttaatagt ataaaggttc 1021 aaatttaaat tgtttcacaa