Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans rhythmically expressed gene 2


LOCUS       XM_013263089            1040 bp    mRNA    linear   INV 02-SEP-2023
            protein (LOC106095762), mRNA.
ACCESSION   XM_013263089
VERSION     XM_013263089.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263089.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1040
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1040
                     /gene="LOC106095762"
                     /note="rhythmically expressed gene 2 protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106095762"
     CDS             200..961
                     /gene="LOC106095762"
                     /codon_start=1
                     /product="rhythmically expressed gene 2 protein"
                     /protein_id="XP_013118543.1"
                     /db_xref="GeneID:106095762"
                     /translation="MASIKCLANLNRFRLVTFDITDTLIRFSRAPAVQYAKTAAQLGV
                     TDIDQVAMERCFKKEFMAMNRQYPNWGCNIPNFTWQQWWSTLVSNIFYCAKPDIDQHK
                     LKELTNILVRTYRTSDCYRHIEGGRELVDRVRNAGKKVGVISNFDPSLKKVLSEVNLA
                     DKFDFILTSYEVGFSKPSKEIYDASLAISKVEAHEALHIGNMYALDYLGARNAGWSSI
                     LITPNEIDLNKAQPTHGFRNIKELLHVLDNDVIEW"
     misc_feature    239..856
                     /gene="LOC106095762"
                     /note="REG-2-like, HAD superfamily (subfamily IA)
                     hydrolase; Region: DREG-2; TIGR02252"
                     /db_xref="CDD:274056"
     polyA_site      1040
                     /gene="LOC106095762"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttctaactgt caaaatttgc ttgctctcgc gctctcttgc tggcaaataa agtacgcgaa
       61 cgacttctaa taaaaatttg tgaaaatttg caaaaatttt tgagttctcg aacacagcta
      121 atataaatgt aaacatatgt tttcataata cttctaatta aaaagataga gataaaaata
      181 tttttgcaag tttttagtta tggctagtat aaagtgctta gctaacctta accgttttcg
      241 cttagtaaca ttcgacataa cagatacatt gatccgcttt agcagagccc cggctgttca
      301 gtatgcgaag acggccgcgc aattaggagt taccgatatt gatcaagtag caatggaaag
      361 atgctttaaa aaggaattca tggccatgaa tagacagtat cccaactggg gttgcaacat
      421 accaaacttc acatggcagc aatggtggtc aaccctggta tccaatattt tctattgtgc
      481 caaacctgac attgatcaac acaaactcaa agaactgacg aacattttag ttcgtactta
      541 tagaacaagt gattgttatc gtcacatcga aggtggcagg gaactggtcg acagagtacg
      601 taatgctggc aagaaagtgg gtgttatttc gaatttcgac ccaagtctga aaaaagtttt
      661 atctgaagta aatttagcgg ataagtttga tttcatattg acatcttatg aagtggggtt
      721 ttcaaaaccg agcaaggaga tttatgatgc atcgctggca attagtaaag ttgaagccca
      781 cgaagcctta catataggaa atatgtatgc cctggattat ttgggtgctc gcaatgctgg
      841 ttggtccagc attctaataa caccgaacga aatcgatctt aacaaggctc aaccaacgca
      901 tggctttcgt aatattaaag aattattgca cgtcttagac aacgatgtta tagaatggta
      961 gtagaataat aacgttttaa atttgcattt tgttaaatta atttaatagt ataaaggttc
     1021 aaatttaaat tgtttcacaa